DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ent2 and slc29a3

DIOPT Version :9

Sequence 1:NP_001285680.1 Gene:Ent2 / 33921 FlyBaseID:FBgn0263916 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_021336388.1 Gene:slc29a3 / 101887173 ZFINID:ZDB-GENE-081107-66 Length:358 Species:Danio rerio


Alignment Length:345 Identity:95/345 - (27%)
Similarity:172/345 - (49%) Gaps:11/345 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 IPNLVFNWLNIFVNFGGDLTTRIVYSIIFEMVILLVTIILAMLDSSQWPGVFFWTTMVCIVLLNV 178
            :|.::|:.. :|::|......||::|::..:|:.:||.:|..:|:|.:...||..|:..:.|::.
Zfish    10 VPLVLFSDC-LFISFRFSSQVRILFSLVVILVVFVVTTVLVKVDTSGYRVQFFEGTLASVALVSG 73

  Fly   179 CNGIYQNTIYGIVASLPIKYTGAVVLGSNISGCFTTAMALICGEIFSSKRTSAIYYFVTAILVLL 243
            .:.|:..:::||....|::.:.|.:.|..:.|..:...:::...:.....:||:.:|::|::..:
Zfish    74 ASNIFTGSVFGISGHFPMRISQAYISGQAMGGTLSAVSSIVDLAVSGDVTSSALVFFLSAVIFTV 138

  Fly   244 LCFDTYFALPLNKFFRHYETI----SRSSEKKSDSKAQLNVPYWQIFKKAAPQLFNIFLTFFVTL 304
            :|...|..||..::.|:|..:    |..|...||:.|....|...|.||.....|.:|..||:::
Zfish   139 VCIIMYLMLPKLEYSRYYMELAALPSTESNGSSDASANSVPPLKPILKKTWVLGFCVFYVFFISI 203

  Fly   305 SVFPAIQSNVH--RSDPNFVVGPDYFTLVTCFATFNVFAMLGSLTTSWVQWPGPRFLWVP--VVL 365
            .:|||:.|.:.  ..|........||..:|.|..:||....|...|:|:|.|||....:|  |:.
Zfish   204 MIFPALSSGIQSMNQDSGNPWSTTYFVPLTSFLLYNVADFSGRQMTAWLQIPGPTSGLLPLLVIS 268

  Fly   366 RLAFIPLFVMCNYVPPDSVRSLAVFIENDWVYWGIGIAMAYSSGYLSSLGMMYAPQTVHTKYQTT 430
            |...:||||.|||.|...:.:  ||..:|.........:..|:|||.:|.|:|.|:.|..:....
Zfish   269 RTILVPLFVFCNYQPRYHLHN--VFFAHDLFPVVFICVLGVSNGYLGTLPMIYGPKVVPRELAEP 331

  Fly   431 AGMYAAAMLITGIFSGVLFS 450
            ||:..:..|..|:..|..||
Zfish   332 AGVIMSFFLTLGLAVGSAFS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ent2NP_001285680.1 Nucleoside_tran 62..457 CDD:301621 95/345 (28%)
slc29a3XP_021336388.1 Nucleoside_tran 65..356 CDD:326577 79/289 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580588
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53699
OrthoDB 1 1.010 - - D318009at33208
OrthoFinder 1 1.000 - - FOG0000541
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2123
SonicParanoid 1 1.000 - - X296
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.650

Return to query results.
Submit another query.