DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ent2 and LOC100334018

DIOPT Version :9

Sequence 1:NP_001285680.1 Gene:Ent2 / 33921 FlyBaseID:FBgn0263916 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_002663054.4 Gene:LOC100334018 / 100334018 -ID:- Length:460 Species:Danio rerio


Alignment Length:463 Identity:138/463 - (29%)
Similarity:205/463 - (44%) Gaps:74/463 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 APKDKFLIVFFIFLLHGVGTLMPWNMFITAKSYFE---DFKFGPNNTVATEVSYRTHFMQNMGFA 111
            ||.|:..:|..||.:.|:|||:|||.|:||..||.   :.....|.|:|:...|  :|...|...
Zfish     5 APADRGFLVAIIFFILGLGTLLPWNFFMTASMYFNKRLNTSESGNGTIASGKEY--YFNNWMTLL 67

  Fly   112 SQIPNLVFNWLNIFVNFGGDLTTRIVYSIIFEMVILLVTIILAMLDSSQWPGVFFWTTMVCIVLL 176
            ||:|.|:|..||..:........||..|::|..::..:|.:|.|:...:  ..||..||..|..:
Zfish    68 SQLPLLLFTLLNSILYPRISEKMRIGGSLVFIFLLFFLTAVLVMIPMEE--DRFFSITMATIWFI 130

  Fly   177 NVCNGIYQNTIYGIVASLPIKYTGAVVLGSNISGCFTTAMALICGEIFSSKRTS-AIYYFVTAIL 240
            |....:.|.:::|:|..||.||:...:.|..::|.| .|:|:|......:|..| |:.||:|..:
Zfish   131 NSFGAVLQGSLFGLVGLLPQKYSAVFMSGQGLAGTF-AALAMIFAIASEAKSDSAALGYFITPCV 194

  Fly   241 VLLLCFDTYFALPLNKFFRHY----------ET-------------------------------- 263
            ..|:...:|..||..:|.|.|          ||                                
Zfish   195 GTLITLFSYMMLPKLEFARFYLENKGKSYELETSRELLPTGDAEVSEKTSEPLNGPVANGTPSNG 259

  Fly   264 ISRSSEKKSDSKAQLNV----------PYWQIFKKAAPQLFNIFLTFFVTLSVFPAIQSNVHRSD 318
            |:..||:.|..:|.:::          ...|:|:|.....|.:...|.||||||||:..:|..: 
Zfish   260 INSVSEEDSGKQAFISLQQESASTQKSSVIQVFRKIWVMAFCVTFVFIVTLSVFPAVTVDVKTA- 323

  Fly   319 PNFVVG---PDYFTLVTCFATFNVFAMLGSLTTSWVQWP--GPRFLWVPVVLRLAFIPLFVMCNY 378
                .|   ..||..|.||..||:....|...||..:||  ..|...:.||.|:.|:||.:|||.
Zfish   324 ----YGGKWEQYFIPVFCFLCFNLCDWAGRTVTSVFKWPHKDSRLFPLLVVSRVIFVPLLMMCNV 384

  Fly   379 VPPDSVRSLAVFIENDWVYWGIGIAMAYSSGYLSSLGMMYAPQTVHTKYQTTAGMYAAAMLITGI 443
               ...::|.|...||:::..|.:..:.||||...|.|.||||.|..|...|||......|..|:
Zfish   385 ---QDRQNLPVLFSNDFIFVFIMLLFSVSSGYFVCLSMTYAPQLVEPKDAETAGALMTFFLALGL 446

  Fly   444 FSGVLFSY 451
            ..|...|:
Zfish   447 SLGAAISF 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ent2NP_001285680.1 Nucleoside_tran 62..457 CDD:301621 133/451 (29%)
LOC100334018XP_002663054.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318009at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.