DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX5B and COX4

DIOPT Version :9

Sequence 1:NP_001285678.1 Gene:COX5B / 33918 FlyBaseID:FBgn0031830 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_011328.1 Gene:COX4 / 852688 SGDID:S000003155 Length:155 Species:Saccharomyces cerevisiae


Alignment Length:85 Identity:30/85 - (35%)
Similarity:41/85 - (48%) Gaps:4/85 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LEHATGIEKRELLLKAAGNDNPFDMKVFKRG-AGTKENPNLIPSAFDARIVGCICEEDQTY-VQW 95
            |:..||:.:.|||.|..|.| .||.|..... .||.::|.:|.|..|.|.|||......:: :.|
Yeast    60 LDQETGLARLELLGKLEGID-VFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHTIMW 123

  Fly    96 MWLQKGNQKRC-ECGHWFKL 114
            :........|| |||..:||
Yeast   124 LKPTVNEVARCWECGSVYKL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX5BNP_001285678.1 Cyt_c_Oxidase_Vb 25..120 CDD:238464 30/85 (35%)
COX4NP_011328.1 COX5B 31..155 CDD:395971 30/85 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346666
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3352
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001825
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102678
Panther 1 1.100 - - LDO PTHR10122
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2075
SonicParanoid 1 1.000 - - X1350
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.