DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX5B and AT1G52710

DIOPT Version :9

Sequence 1:NP_001285678.1 Gene:COX5B / 33918 FlyBaseID:FBgn0031830 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_175680.2 Gene:AT1G52710 / 841704 AraportID:AT1G52710 Length:90 Species:Arabidopsis thaliana


Alignment Length:65 Identity:24/65 - (36%)
Similarity:32/65 - (49%) Gaps:12/65 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DNPFDMKVFKRGAGTKENPNLIPSAFDARIVGCIC--EEDQTYVQWMWLQKGNQKRCE-CGHWFK 113
            ::||         ||||:|.::.|.||.|.:||..  .||...|.|.||.||....|. |..:|:
plant    20 ESPF---------GTKESPAVVQSYFDKRNIGCRGGEGEDGHDVVWFWLDKGKSFECPVCSQYFE 75

  Fly   114  113
            plant    76  75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX5BNP_001285678.1 Cyt_c_Oxidase_Vb 25..120 CDD:238464 24/65 (37%)
AT1G52710NP_175680.2 Cyt_c_Oxidase_Vb <4..90 CDD:294021 24/65 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4262
eggNOG 1 0.900 - - E1_KOG3352
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I2598
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528134at2759
OrthoFinder 1 1.000 - - FOG0001825
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1350
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.