powered by:
Protein Alignment COX5B and AT1G52710
DIOPT Version :9
Sequence 1: | NP_001285678.1 |
Gene: | COX5B / 33918 |
FlyBaseID: | FBgn0031830 |
Length: | 120 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_175680.2 |
Gene: | AT1G52710 / 841704 |
AraportID: | AT1G52710 |
Length: | 90 |
Species: | Arabidopsis thaliana |
Alignment Length: | 65 |
Identity: | 24/65 - (36%) |
Similarity: | 32/65 - (49%) |
Gaps: | 12/65 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 DNPFDMKVFKRGAGTKENPNLIPSAFDARIVGCIC--EEDQTYVQWMWLQKGNQKRCE-CGHWFK 113
::|| ||||:|.::.|.||.|.:||.. .||...|.|.||.||....|. |..:|:
plant 20 ESPF---------GTKESPAVVQSYFDKRNIGCRGGEGEDGHDVVWFWLDKGKSFECPVCSQYFE 75
Fly 114 113
plant 76 75
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
52 |
1.000 |
Domainoid score |
I4262 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3352 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
55 |
1.000 |
Inparanoid score |
I2598 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528134at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001825 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1350 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
8 | 7.870 |
|
Return to query results.
Submit another query.