DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX5B and AT3G15640

DIOPT Version :9

Sequence 1:NP_001285678.1 Gene:COX5B / 33918 FlyBaseID:FBgn0031830 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_188185.1 Gene:AT3G15640 / 820806 AraportID:AT3G15640 Length:176 Species:Arabidopsis thaliana


Alignment Length:126 Identity:42/126 - (33%)
Similarity:55/126 - (43%) Gaps:29/126 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ALRAAARQNVAYTPVRF---------CKMMNDPLEHATGIEKRELLLKAAGN--------DNPFD 56
            |.|:|...:....|.||         .|.:.|.:..|||.||.||..:..|.        :.|| 
plant    39 ANRSAISASSFVIPRRFSSDSVETPATKKVEDVMPIATGHEKEELEAELEGRRLDDIDFPEGPF- 102

  Fly    57 MKVFKRGAGTKENPNLIPSAFDARIVGCIC--EEDQTYVQWMWLQKGNQKRCE-CGHWFKL 114
                    ||||.|.::.|.:|.|||||..  .||:..|.|.||:||....|. |..:|:|
plant   103 --------GTKEAPAIVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKSFECPVCTQYFEL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX5BNP_001285678.1 Cyt_c_Oxidase_Vb 25..120 CDD:238464 37/110 (34%)
AT3G15640NP_188185.1 PLN02294 1..176 CDD:177931 42/126 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4262
eggNOG 1 0.900 - - E1_KOG3352
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I2598
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528134at2759
OrthoFinder 1 1.000 - - FOG0001825
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102678
Panther 1 1.100 - - LDO PTHR10122
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1350
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.