DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX5B and cox5b.2

DIOPT Version :9

Sequence 1:NP_001285678.1 Gene:COX5B / 33918 FlyBaseID:FBgn0031830 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001037898.1 Gene:cox5b.2 / 733498 XenbaseID:XB-GENE-5920075 Length:131 Species:Xenopus tropicalis


Alignment Length:82 Identity:36/82 - (43%)
Similarity:51/82 - (62%) Gaps:2/82 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EHATGIEKRELLLKAAGNDNPFDMKVFKRGAGTKENPNLIPSAFDARIVGCICEEDQTYVQWMWL 98
            |.|||:|::.|.....|.| |:.:...|...||||:|:::||....||||||||||.:.:.|.|:
 Frog    44 EQATGLERKTLQAMKKGLD-PYSILKPKSYLGTKEDPHIVPSINKKRIVGCICEEDNSAIIWFWV 107

  Fly    99 QKGNQKRC-ECGHWFKL 114
            .:|..:|| .||..:||
 Frog   108 HEGPAQRCPSCGAHYKL 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX5BNP_001285678.1 Cyt_c_Oxidase_Vb 25..120 CDD:238464 36/82 (44%)
cox5b.2NP_001037898.1 Cyt_c_Oxidase_Vb 34..130 CDD:238464 36/82 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8223
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I5024
OMA 1 1.010 - - QHG49346
OrthoDB 1 1.010 - - D1528134at2759
OrthoFinder 1 1.000 - - FOG0001825
OrthoInspector 1 1.000 - - mtm9423
Panther 1 1.100 - - O PTHR10122
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1350
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.