DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX5B and cox5b.1

DIOPT Version :9

Sequence 1:NP_001285678.1 Gene:COX5B / 33918 FlyBaseID:FBgn0031830 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001016250.1 Gene:cox5b.1 / 549004 XenbaseID:XB-GENE-964002 Length:126 Species:Xenopus tropicalis


Alignment Length:121 Identity:50/121 - (41%)
Similarity:69/121 - (57%) Gaps:7/121 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAS-ICGRMALRAAARQNVA--YTPVRFCKMMNDPL--EHATGIEKRELLLKAAGNDNPFDMKVF 60
            ||| :..|.|::|..|....  ..|.|.......|.  |.|||:||:.:.....|.| |:.::..
 Frog     1 MASRLLFRRAVQAVTRVGAVRLAAPSRCMSAGGIPTDEEQATGLEKKVMAAIKKGTD-PYSIEKP 64

  Fly    61 KRGAGTKENPNLIPSAFDARIVGCICEEDQTYVQWMWLQKGNQKRC-ECGHWFKLV 115
            ::.|||||:|:::||..:.||||||||||.|.|.|.||.:|..:|| .||..:|||
 Frog    65 QQYAGTKEDPHIVPSITNKRIVGCICEEDNTAVIWFWLHEGEAQRCPSCGSHYKLV 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX5BNP_001285678.1 Cyt_c_Oxidase_Vb 25..120 CDD:238464 41/94 (44%)
cox5b.1NP_001016250.1 Cyt_c_Oxidase_Vb 29..125 CDD:238464 41/93 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8223
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I5024
OMA 1 1.010 - - QHG49346
OrthoDB 1 1.010 - - D1528134at2759
OrthoFinder 1 1.000 - - FOG0001825
OrthoInspector 1 1.000 - - mtm9423
Panther 1 1.100 - - LDO PTHR10122
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2075
SonicParanoid 1 1.000 - - X1350
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.