DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX5B and cox5ba

DIOPT Version :9

Sequence 1:NP_001285678.1 Gene:COX5B / 33918 FlyBaseID:FBgn0031830 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001002163.1 Gene:cox5ba / 415253 ZFINID:ZDB-GENE-040625-180 Length:126 Species:Danio rerio


Alignment Length:129 Identity:49/129 - (37%)
Similarity:68/129 - (52%) Gaps:26/129 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ICGRMALRAAARQNVAYTPVRFCKMMNDPL----------------EHATGIEKRELLLKAAGND 52
            :..|:.||.|.|  .|.|    ||  :.|:                |.|||:||:.:.....|:|
Zfish     1 MAARLLLRGAVR--AATT----CK--SRPVLVVSRGMAAGGIPTDEEQATGLEKKIMTALKTGSD 57

  Fly    53 NPFDMKVFKRGAGTKENPNLIPSAFDARIVGCICEEDQTYVQWMWLQKGNQKRC-ECGHWFKLV 115
             |:.|...|..||:|.:|:::||..:.|||||:||||.|.|.|.||.:|..:|| .||..:|||
Zfish    58 -PYSMLKPKSYAGSKSDPHIVPSITNKRIVGCVCEEDNTAVVWFWLHEGEAQRCPSCGSHYKLV 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX5BNP_001285678.1 Cyt_c_Oxidase_Vb 25..120 CDD:238464 42/108 (39%)
cox5baNP_001002163.1 Cyt_c_Oxidase_Vb 29..125 CDD:238464 39/93 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596424
Domainoid 1 1.000 81 1.000 Domainoid score I8432
eggNOG 1 0.900 - - E1_KOG3352
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5189
OMA 1 1.010 - - QHG49346
OrthoDB 1 1.010 - - D1528134at2759
OrthoFinder 1 1.000 - - FOG0001825
OrthoInspector 1 1.000 - - mtm6423
orthoMCL 1 0.900 - - OOG6_102678
Panther 1 1.100 - - O PTHR10122
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2075
SonicParanoid 1 1.000 - - X1350
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.