DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX5B and cox4

DIOPT Version :9

Sequence 1:NP_001285678.1 Gene:COX5B / 33918 FlyBaseID:FBgn0031830 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_593042.1 Gene:cox4 / 2543025 PomBaseID:SPAC1296.02 Length:164 Species:Schizosaccharomyces pombe


Alignment Length:85 Identity:32/85 - (37%)
Similarity:46/85 - (54%) Gaps:4/85 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LEHATGIEKRELLLKAAGNDNPFDMKVFKRG-AGTKENPNLIPSAFDARIVGCICEEDQTY-VQW 95
            ||.|||:|:.|||.:.:|.| .||||..... .||..:|.::.|....|.:||......:: :.|
pombe    69 LEQATGLERYELLSELSGRD-AFDMKPLDASRKGTLTDPIMVTSLDPYRHIGCTGSPSGSHNLIW 132

  Fly    96 MWLQKGNQKRC-ECGHWFKL 114
            |.:.|...:|| |||..:||
pombe   133 MTVYKDKLRRCPECGSVYKL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX5BNP_001285678.1 Cyt_c_Oxidase_Vb 25..120 CDD:238464 32/85 (38%)
cox4NP_593042.1 COX5B 37..164 CDD:279547 32/85 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I3504
eggNOG 1 0.900 - - E1_KOG3352
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2072
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001825
OrthoInspector 1 1.000 - - oto102081
orthoMCL 1 0.900 - - OOG6_102678
Panther 1 1.100 - - LDO PTHR10122
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2075
SonicParanoid 1 1.000 - - X1350
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.