DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX5B and cox-5B

DIOPT Version :9

Sequence 1:NP_001285678.1 Gene:COX5B / 33918 FlyBaseID:FBgn0031830 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_492601.1 Gene:cox-5B / 172832 WormBaseID:WBGene00000371 Length:132 Species:Caenorhabditis elegans


Alignment Length:116 Identity:54/116 - (46%)
Similarity:77/116 - (66%) Gaps:10/116 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASICGRMALRAAARQNVAYTPVRFCKMMNDPLEHATGIEKRELLLKAAGNDNPFDMKVFKRG-AG 65
            |::..|.....|:.::..|.|        ||||||||.||:.||.:.||:|. ::.||:.|. |.
 Worm    20 AAVARRTLATEASPEDYGYYP--------DPLEHATGREKKMLLARLAGDDR-YEPKVYYRAEAS 75

  Fly    66 TKENPNLIPSAFDARIVGCICEEDQTYVQWMWLQKGNQKRCECGHWFKLVE 116
            ||:.|||:||.:|.||:||:||:|..:|.:|.::||:.||||||||||.|:
 Worm    76 TKQKPNLVPSHYDFRIIGCMCEQDSGHVNFMTIRKGDPKRCECGHWFKGVD 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX5BNP_001285678.1 Cyt_c_Oxidase_Vb 25..120 CDD:238464 49/93 (53%)
cox-5BNP_492601.1 Cyt_c_Oxidase_Vb 36..130 CDD:238464 51/100 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I4382
eggNOG 1 0.900 - - E1_KOG3352
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44294
Inparanoid 1 1.050 109 1.000 Inparanoid score I3476
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49346
OrthoDB 1 1.010 - - D1528134at2759
OrthoFinder 1 1.000 - - FOG0001825
OrthoInspector 1 1.000 - - oto17181
orthoMCL 1 0.900 - - OOG6_102678
Panther 1 1.100 - - LDO PTHR10122
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2075
SonicParanoid 1 1.000 - - X1350
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.910

Return to query results.
Submit another query.