DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX5B and COX5B

DIOPT Version :9

Sequence 1:NP_001285678.1 Gene:COX5B / 33918 FlyBaseID:FBgn0031830 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001853.2 Gene:COX5B / 1329 HGNCID:2269 Length:129 Species:Homo sapiens


Alignment Length:83 Identity:43/83 - (51%)
Similarity:57/83 - (68%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EHATGIEKRELLLKAAGNDNPFDMKVFKRGAGTKENPNLIPSAFDARIVGCICEEDQTYVQWMWL 98
            |.|||:| ||::|.|....:|:::...|..:||:|:|||:||..:.||||||||||.|.|.|.||
Human    42 EQATGLE-REIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWL 105

  Fly    99 QKGNQKRC-ECGHWFKLV 115
            .||..:|| .||..:|||
Human   106 HKGEAQRCPRCGAHYKLV 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX5BNP_001285678.1 Cyt_c_Oxidase_Vb 25..120 CDD:238464 43/83 (52%)
COX5BNP_001853.2 Cyt_c_Oxidase_Vb 32..128 CDD:238464 43/83 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160104
Domainoid 1 1.000 87 1.000 Domainoid score I8052
eggNOG 1 0.900 - - E1_KOG3352
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5155
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49346
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001825
OrthoInspector 1 1.000 - - oto91648
orthoMCL 1 0.900 - - OOG6_102678
Panther 1 1.100 - - LDO PTHR10122
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2075
SonicParanoid 1 1.000 - - X1350
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.