DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX5B and cox5bb

DIOPT Version :9

Sequence 1:NP_001285678.1 Gene:COX5B / 33918 FlyBaseID:FBgn0031830 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001373327.1 Gene:cox5bb / 100002384 ZFINID:ZDB-GENE-100525-2 Length:127 Species:Danio rerio


Alignment Length:122 Identity:46/122 - (37%)
Similarity:66/122 - (54%) Gaps:11/122 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ICGRMALRAAARQNV-------AYTPVRFCKMMNDPL--EHATGIEKRELLLKAAGNDNPFDMKV 59
            :..|:.||:|.|..|       |....|.......|.  |.|||:|:..:.....|.| |:::..
Zfish     1 MAARLLLRSATRAVVLRHRTLPAPAVARALASGGIPTDDEQATGLERIVMEASKKGLD-PYNILK 64

  Fly    60 FKRGAGTKENPNLIPSAFDARIVGCICEEDQTYVQWMWLQKGNQKRC-ECGHWFKLV 115
            .|..||:|::|:::||....|||||:||||.|.|.|.||.:|..:|| .||.::|||
Zfish    65 PKEYAGSKQDPHIVPSISTKRIVGCVCEEDNTAVVWFWLHQGEAQRCPSCGAYYKLV 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX5BNP_001285678.1 Cyt_c_Oxidase_Vb 25..120 CDD:238464 38/94 (40%)
cox5bbNP_001373327.1 Cyt_c_Oxidase_Vb 33..126 CDD:238464 38/90 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596423
Domainoid 1 1.000 81 1.000 Domainoid score I8432
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5189
OMA 1 1.010 - - QHG49346
OrthoDB 1 1.010 - - D1528134at2759
OrthoFinder 1 1.000 - - FOG0001825
OrthoInspector 1 1.000 - - mtm6423
orthoMCL 1 0.900 - - OOG6_102678
Panther 1 1.100 - - O PTHR10122
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1350
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.