DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31637 and CHST1

DIOPT Version :9

Sequence 1:NP_001285677.1 Gene:CG31637 / 33914 FlyBaseID:FBgn0051637 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_006718419.1 Gene:CHST1 / 8534 HGNCID:1969 Length:432 Species:Homo sapiens


Alignment Length:362 Identity:92/362 - (25%)
Similarity:153/362 - (42%) Gaps:83/362 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 GGAERLTDMTPE-----TNGTPVRSVVVTSWRSGSTFLGDILNSIPGNFYHYEPL------LDFG 220
            |.||||.:.:|.     :..|.:  :::.:.||||:|:|.:.|.....||.:|||      |...
Human    41 GLAERLCEESPTFAYNLSRKTHI--LILATTRSGSSFVGQLFNQHLDVFYLFEPLYHVQNTLIPR 103

  Fly   221 IKQIRDPDDQELAV----QNLKNLLNCDYADMIDYLNFGKTHTYLFEHNTRLWDVCREFPR---- 277
            ..|.:.|.|:.:.:    ..|::|.:||...:.:|:.....:     |.|.     |.|.|    
Human   104 FTQGKSPADRRVMLGASRDLLRSLYDCDLYFLENYIKPPPVN-----HTTD-----RIFRRGASR 158

  Fly   278 -FCWRPAF--------------LTRFCRLFPIQ------------SMKTVRL-RLAQAEKLLEDQ 314
             .|.||..              ..|.|.|..:.            ::||||: .:.....|:||.
Human   159 VLCSRPVCDPPGPADLVLEEGDCVRKCGLLNLTVAAEACRERSHVAIKTVRVPEVNDLRALVEDP 223

  Fly   315 SLSSVRIVLLVRDPRGTMQSRRH---------RVWCGG-----NEDCEDPRLVCQDLRDDYKTAE 365
            .| :::::.|||||||.:.||..         |:|.|.     |.|......||:|..:...|. 
Human   224 RL-NLKVIQLVRDPRGILASRSETFRDTYRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTG- 286

  Fly   366 VLLLKYP---SRFRTVRYEDLSLSPSEMTQDILQFYGLPFDPAVEEFLDTHTK--VNIGGVS-ST 424
              |::.|   .::..||||||:.:|.:.|::|..|.|:|.|..|..::..:|:  ..:|... .|
Human   287 --LMRPPWLKGKYMLVRYEDLARNPMKKTEEIYGFLGIPLDSHVARWIQNNTRGDPTLGKHKYGT 349

  Fly   425 YRDSRSAPFHWMQDLKPEEIKQIQDVCTEAMDLWGYR 461
            .|:|.:....|...|..:.:...|:.|.:.:...||:
Human   350 VRNSAATAEKWRFRLSYDIVAFAQNACQQVLAQLGYK 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31637NP_001285677.1 Sulfotransfer_1 187..459 CDD:304426 83/333 (25%)
CHST1XP_006718419.1 Sulfotransfer_1 60..384 CDD:279075 84/339 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144875
Domainoid 1 1.000 84 1.000 Domainoid score I8227
eggNOG 1 0.900 - - E1_299AF
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5104
Isobase 1 0.950 - 1 Normalized mean entropy S8048
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1246608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8642
orthoMCL 1 0.900 - - OOG6_102425
Panther 1 1.100 - - O PTHR10704
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X233
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.710

Return to query results.
Submit another query.