DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31637 and Chst5

DIOPT Version :9

Sequence 1:NP_001285677.1 Gene:CG31637 / 33914 FlyBaseID:FBgn0051637 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_064334.1 Gene:Chst5 / 56773 MGIID:1931825 Length:395 Species:Mus musculus


Alignment Length:352 Identity:103/352 - (29%)
Similarity:156/352 - (44%) Gaps:73/352 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 RLTDMTPETNGTPVRSVVVTSWRSGSTFLGDILNSIPGNFYHYEPLLDFGIKQIRDPDDQ----- 230
            |....:|...|..|..:|::||||||:|:|.:.:..|..||..||..     .:.|...|     
Mouse    28 RQVPSSPAGLGERVHVLVLSSWRSGSSFVGQLFSQHPDVFYLMEPAW-----HVWDTLSQGSAPA 87

  Fly   231 -ELAVQNL-KNLLNCDYADMID-YLNFGKTHTYLFEHNTRLW---------DVCREFPR------ 277
             .:||::| :::..|| .|:.| ||.:.:..:.||:     |         .||..|.|      
Mouse    88 LHMAVRDLIRSVFLCD-MDVFDAYLPWRRNISDLFQ-----WAVSRALCSPPVCEAFARGNISSE 146

  Fly   278 -FCWRPAFLTR-------FCRLFPIQSMKTVR-LRLAQAEKLLEDQSLSSVRIVLLVRDPRGTMQ 333
             .| :|...||       .|..:....:|.|| ..|.....||.|.:| ::|||.||||||..::
Mouse   147 EVC-KPLCATRPFGLAQEACSSYSHVVLKEVRFFNLQVLYPLLSDPAL-NLRIVHLVRDPRAVLR 209

  Fly   334 SRR---------HRVWCGGNEDC--EDPRL-----VCQDLRDDYKTAEVLLLKYP----SRFRTV 378
            ||.         :.:..|.|...  .||||     ||   |...:.||..|.|.|    .|:|.|
Mouse   210 SREQTAKALARDNGIVLGTNGTWVEADPRLRVVNEVC---RSHVRIAEAALHKPPPFLQDRYRLV 271

  Fly   379 RYEDLSLSPSEMTQDILQFYGLPFDPAVEEFLDTHTKVNIGGV-----SSTYRDSRSAPFHWMQD 438
            |||||:..|..:.:::..|.||...|.::.::...|..:..|.     .:|.||:.|....|...
Mouse   272 RYEDLARDPLTVIRELYAFTGLGLTPQLQTWIHNITHGSGPGARREAFKTTSRDALSVSQAWRHT 336

  Fly   439 LKPEEIKQIQDVCTEAMDLWGYRRIEN 465
            |...:|:::|::|..|:.|.|||.:.:
Mouse   337 LPFAKIRRVQELCGGALQLLGYRSVHS 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31637NP_001285677.1 Sulfotransfer_1 187..459 CDD:304426 96/328 (29%)
Chst5NP_064334.1 Sulfotransfer_1 <167..357 CDD:304426 59/193 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834973
Domainoid 1 1.000 91 1.000 Domainoid score I7657
eggNOG 1 0.900 - - E1_299AF
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H56927
Inparanoid 1 1.050 99 1.000 Inparanoid score I4986
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1246608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8874
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10704
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5525
SonicParanoid 1 1.000 - - X233
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.890

Return to query results.
Submit another query.