DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31637 and Chst2

DIOPT Version :9

Sequence 1:NP_001285677.1 Gene:CG31637 / 33914 FlyBaseID:FBgn0051637 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_061233.2 Gene:Chst2 / 54371 MGIID:1891160 Length:530 Species:Mus musculus


Alignment Length:396 Identity:105/396 - (26%)
Similarity:156/396 - (39%) Gaps:107/396 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 GGAERLTDMTPETNGTPVRSVVV---TSWRSGSTFLGDILNSIPGNFYHYEPLLDFGIKQIRDPD 228
            |.|..|.:.|..|.|...:..:|   |:|||||:|.|::.|..|..|:.|||:  :.:.|...|.
Mouse   145 GAAASLGNATRGTRGGGDKRQLVYVFTTWRSGSSFFGELFNQNPEVFFLYEPV--WHVWQKLYPG 207

  Fly   229 D----QELAVQNLKNLLNCDYADMIDYLNFGK-----THTYLFEHNTR----------------- 267
            |    |..|...|..|..||.:....|...|.     |...:|...|.                 
Mouse   208 DAVSLQGAARDMLSALYRCDLSVFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVV 272

  Fly   268 -LWD--VCREFPRFCWRPAFLTRF---CRLFPIQSMKTVRL-RLAQAEKLLEDQSLSSVRIVLLV 325
             |.|  ||::.|     |..|.||   ||.:....:|.||: .:|....||:|.:| .::::.||
Mouse   273 GLVDDRVCKKCP-----PQRLARFEEECRKYRTLVIKGVRVFDVAVLAPLLKDPAL-DLKVIHLV 331

  Fly   326 RDPRGTMQSR---RHRVWCGGNEDCE-----DPR------------------------------- 351
            ||||....||   ||.:.   .|..:     |||                               
Mouse   332 RDPRAVASSRIRSRHGLI---RESLQVVRSRDPRAHRMPFLEAAGHKLGAKKEGMGGPADYHALG 393

  Fly   352 ---LVCQDLRDDYKTAEVLLLKYP----SRFRTVRYEDLSLSPSEMTQDILQFYGLPFDPAVEEF 409
               ::|..:....:||    |:.|    ..:..||||||...|.:..:.:..|.||...|.:|:|
Mouse   394 AMEVICNSMAKTLQTA----LQPPDWLQGHYLVVRYEDLVGDPVKTLRRVYDFVGLLVSPEMEQF 454

  Fly   410 LDTHTKVNIGGVSS-----TYRDSRSAPFHWMQDLKPEEIKQIQDVCTEAMDLWGYRRI---ENF 466
            ....|..:  |.||     :.|::..|...|...|..::|||:::.|.:.|.:.||.|:   |..
Mouse   455 ALNMTSGS--GSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEV 517

  Fly   467 NNFSTT 472
            .:.|.|
Mouse   518 KDLSKT 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31637NP_001285677.1 Sulfotransfer_1 187..459 CDD:304426 93/358 (26%)
Chst2NP_061233.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..128
Sulfotransfer_3 <311..507 CDD:328790 50/205 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834979
Domainoid 1 1.000 91 1.000 Domainoid score I7657
eggNOG 1 0.900 - - E1_299AF
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I4986
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1246608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8874
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10704
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X233
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.860

Return to query results.
Submit another query.