DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31637 and Chst3

DIOPT Version :9

Sequence 1:NP_001285677.1 Gene:CG31637 / 33914 FlyBaseID:FBgn0051637 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_058083.2 Gene:Chst3 / 53374 MGIID:1858224 Length:478 Species:Mus musculus


Alignment Length:392 Identity:99/392 - (25%)
Similarity:167/392 - (42%) Gaps:77/392 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 QQSSQTAVYNLTATIVDVLSAQRSRI------LAEMENFEYPRGGAERLTDMTPETNGTPVRSVV 188
            :.:|..::..|.:|    .|..|||:      |......|....|||:.:.....  ||....::
Mouse    79 ENASLLSLSELDST----FSHLRSRLHNLSLQLGVEPAMESQEAGAEKPSQQAGA--GTRRHVLL 137

  Fly   189 VTSWRSGSTFLGDILNSIPGNFYHYEPLLD-----FGIKQIRDPDDQELAVQN-LKNLLNCDYAD 247
            :.:.|:||:|:|:..|.....||.:|||..     |..::........|..:: ||.||.||...
Mouse   138 MATTRTGSSFVGEFFNQQGNIFYLFEPLWHIERTVFFQQRGASAAGSALVYRDVLKQLLLCDLYV 202

  Fly   248 M--------IDYLNFGKTHTYLFEHNTRLWDVCRE----------FPRFCWR-----PAFLT--- 286
            :        .|:|.     .:||...:.. .:|.:          |.::..|     |..:|   
Mouse   203 LEPFISPPPEDHLT-----QFLFRRGSSR-SLCEDPVCTPFVKKVFEKYHCRNRRCGPLNVTLAG 261

  Fly   287 RFCRLFPIQSMKTVRLR-LAQAEKLLEDQSLSSVRIVLLVRDPRGTMQSR---------RHRVWC 341
            ..||.....::|.||:| |...:.|:||..| .:|::.||||||..:.||         ..:.|.
Mouse   262 EACRRKDHVALKAVRIRQLEFLQPLVEDPRL-DLRVIQLVRDPRAVLASRIVAFAGKYENWKKWL 325

  Fly   342 GGNED--CEDP----RLVCQDLRDDYKTAEVLLLKYPS----RFRTVRYEDLSLSPSEMTQDILQ 396
            ...:|  .||.    |..|:.:|   .:|| |.|:.|:    |:..|||||::..|.:..:::..
Mouse   326 SEGQDQLSEDEVQRLRGNCESIR---LSAE-LGLRQPAWLRGRYMLVRYEDVARRPLQKAREMYS 386

  Fly   397 FYGLPFDPAVEEFLDTHTKV--NIGGVSSTYRDSRSAPFHWMQDLKPEEIKQIQDVCTEAMDLWG 459
            |.|:|..|.||:::..:|:.  :...|.||.::|......|...:..:..:.:|..|...|.|:|
Mouse   387 FAGIPLTPQVEDWIQKNTQATRDSSDVYSTQKNSSEQFEKWRFSMPFKLAQVVQAACGPTMHLFG 451

  Fly   460 YR 461
            |:
Mouse   452 YK 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31637NP_001285677.1 Sulfotransfer_1 187..459 CDD:304426 83/325 (26%)
Chst3NP_058083.2 Sulfotransfer_1 <265..451 CDD:366246 54/190 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834977
Domainoid 1 1.000 91 1.000 Domainoid score I7657
eggNOG 1 0.900 - - E1_299AF
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I4986
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1246608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8874
orthoMCL 1 0.900 - - OOG6_102425
Panther 1 1.100 - - LDO PTHR10704
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X233
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.760

Return to query results.
Submit another query.