DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31637 and CHST6

DIOPT Version :9

Sequence 1:NP_001285677.1 Gene:CG31637 / 33914 FlyBaseID:FBgn0051637 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_067628.1 Gene:CHST6 / 4166 HGNCID:6938 Length:395 Species:Homo sapiens


Alignment Length:355 Identity:101/355 - (28%)
Similarity:151/355 - (42%) Gaps:83/355 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 PRGGAERLTDMTPETNGTPVRSVVVTSWRSGSTFLGDILNSIPGNFYHYEP------LLDFGIKQ 223
            |.||..|            |..:|::||||||:|:|.:.|..|..||..||      .|..|   
Human    34 PAGGEAR------------VHVLVLSSWRSGSSFVGQLFNQHPDVFYLMEPAWHVWTTLSQG--- 83

  Fly   224 IRDPDDQELAVQNL-KNLLNCDYADMID-YLNFGKTHTYLFEHNTRLWDV---------CREFPR 277
              ......:||::| :::..|| .|:.| ||.:.:..:.||:     |.|         |..|||
Human    84 --SAATLHMAVRDLVRSVFLCD-MDVFDAYLPWRRNLSDLFQ-----WAVSRALCSPPACSAFPR 140

  Fly   278 -----------FCWRPAF-LTR-FCRLFPIQSMKTVR-LRLAQAEKLLEDQSLSSVRIVLLVRDP 328
                       .|.|.:| |.| .||.:....:|.|| ..|.....||.|.:| ::|||.|||||
Human   141 GAISSEAVCKPLCARQSFTLAREACRSYSHVVLKEVRFFNLQVLYPLLSDPAL-NLRIVHLVRDP 204

  Fly   329 RGTMQSRR----------------HRVWCGGNEDCEDPRLVCQDLRDDYKTAEVLLLKYP----S 373
            |..::||.                :..|...:......|.||   |...:.||...||.|    .
Human   205 RAVLRSREQTAKALARDNGIVLGTNGTWVEADPGLRVVREVC---RSHVRIAEAATLKPPPFLRG 266

  Fly   374 RFRTVRYEDLSLSPSEMTQDILQFYGLPFDPAVEEFLDTHTKVNIGGV-----SSTYRDSRSAPF 433
            |:|.||:|||:..|....:.:..|.||...|.:|.::...|..:..|.     .::.|::.:...
Human   267 RYRLVRFEDLAREPLAEIRALYAFTGLSLTPQLEAWIHNITHGSGPGARREAFKTSSRNALNVSQ 331

  Fly   434 HWMQDLKPEEIKQIQDVCTEAMDLWGYRRI 463
            .|...|...:|:::|::|..|:.|.|||.:
Human   332 AWRHALPFAKIRRVQELCAGALQLLGYRPV 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31637NP_001285677.1 Sulfotransfer_1 187..459 CDD:304426 93/327 (28%)
CHST6NP_067628.1 Sulfotransfer_3 43..297 CDD:316030 81/268 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144865
Domainoid 1 1.000 84 1.000 Domainoid score I8227
eggNOG 1 0.900 - - E1_299AF
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H56927
Inparanoid 1 1.050 91 1.000 Inparanoid score I5104
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1246608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8642
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10704
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5525
SonicParanoid 1 1.000 - - X233
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.890

Return to query results.
Submit another query.