DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31637 and Chst5

DIOPT Version :9

Sequence 1:NP_001285677.1 Gene:CG31637 / 33914 FlyBaseID:FBgn0051637 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001100901.1 Gene:Chst5 / 307859 RGDID:1561144 Length:418 Species:Rattus norvegicus


Alignment Length:423 Identity:119/423 - (28%)
Similarity:181/423 - (42%) Gaps:95/423 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 GRDQGASVDGGP-SNSLARSAFYDRFQQQLQQQQQSSQTAVYNL----TATIVDVLSAQRSRILA 157
            ||...:|.:..| :.:|||.....||          |.|.|.:|    |..:|.::|.|      
  Rat     4 GRAAQSSTEAQPAAQALARGMRLPRF----------SSTVVLSLLIVQTGILVFLVSRQ------ 52

  Fly   158 EMENFEYPRGGAERLTDMTPETNGTPVRSVVVTSWRSGSTFLGDILNSIPGNFYHYEPLLDF--G 220
                           ...:|...|..|..:|::||||||:|:|.:.:..|..||..||....  .
  Rat    53 ---------------MPSSPAGRGEHVHVLVLSSWRSGSSFVGQLFSQHPDVFYLMEPAWHVWDA 102

  Fly   221 IKQIRDPDDQELAVQNL-KNLLNCDYADMID-YLNFGKTHTYLFEHNTRLW---------DVCRE 274
            :.|...| ...:||::| :::..|| .|:.| ||.:.:..:.||:     |         .||..
  Rat   103 LSQASAP-ALHMAVRDLIRSVFLCD-MDVFDAYLPWRRNISDLFQ-----WAVSRALCSPPVCDA 160

  Fly   275 FPR-------FCWRPAFLTR-------FCRLFPIQSMKTVR-LRLAQAEKLLEDQSLSSVRIVLL 324
            |.|       .| :|...||       .|..:....:|.|| ..|.....||.|.:| ::|||.|
  Rat   161 FARGNISSEEVC-KPLCATRPFGLAQEACSSYSHVVLKEVRFFNLQVLYPLLSDPAL-NLRIVHL 223

  Fly   325 VRDPRGTMQSRR---------HRVWCGGNEDC--EDPRL--VCQDLRDDYKTAEVLLLKYP---- 372
            |||||..::||.         :.:..|.|...  .||||  |.:..|...:.|||.|.|.|    
  Rat   224 VRDPRAVLRSREQTAKALARDNGIVLGTNGTWVEADPRLRVVSEVCRSHVRIAEVALHKPPPFLQ 288

  Fly   373 SRFRTVRYEDLSLSPSEMTQDILQFYGLPFDPAVEEFLDTHTKVNIGGV-----SSTYRDSRSAP 432
            .|:|.||||||:..|..:.:::..|.||...|.::.::...|..:..|.     .:|.||:.|..
  Rat   289 DRYRLVRYEDLARDPLTVIRELYAFTGLGLTPQLQTWIYNITHGSGPGARREAFKTTSRDALSVS 353

  Fly   433 FHWMQDLKPEEIKQIQDVCTEAMDLWGYRRIEN 465
            ..|...|...:|:::|::|..|:.|.|||.:.:
  Rat   354 QAWRHTLPFAKIRRVQELCAGALQLLGYRPVHS 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31637NP_001285677.1 Sulfotransfer_1 187..459 CDD:304426 96/321 (30%)
Chst5NP_001100901.1 Sulfotransfer_1 <190..380 CDD:304426 59/190 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338562
Domainoid 1 1.000 86 1.000 Domainoid score I7883
eggNOG 1 0.900 - - E1_299AF
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H56927
Inparanoid 1 1.050 97 1.000 Inparanoid score I4931
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1246608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9120
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10704
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X233
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.860

Return to query results.
Submit another query.