DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31637 and Chst4

DIOPT Version :9

Sequence 1:NP_001285677.1 Gene:CG31637 / 33914 FlyBaseID:FBgn0051637 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_036128.3 Gene:Chst4 / 26887 MGIID:1349479 Length:388 Species:Mus musculus


Alignment Length:346 Identity:92/346 - (26%)
Similarity:150/346 - (43%) Gaps:76/346 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 ETNGTPVRSVVVTSWRSGSTFLGDILNSIPGNFYHYEPL--------------LDFGIKQIRDPD 228
            |.:..||..:|::||||||:|:|.:....|..||..||.              |...::.:    
Mouse    36 EESRRPVHVLVLSSWRSGSSFVGQLFGQHPDVFYLMEPAWHVWMTFTSSTAWKLHMAVRDL---- 96

  Fly   229 DQELAVQNLKNLLNCDYADMIDYLNFG-KTHTYLFEHNTRLWD---------VCREFPR------ 277
                    |:::..||.:....|:|.| :..:.||:     |:         ||..||.      
Mouse    97 --------LRSVFLCDMSVFDAYMNPGPRKQSSLFQ-----WEQSRALCSAPVCDFFPAHEISSP 148

  Fly   278 -----FCWRPAF--LTRFCRLFPIQSMKTVR-LRLAQAEKLLEDQSLSSVRIVLLVRDPRGTMQS 334
                 .|.:..|  :.:.||......:|.|| |.|.....||.|.|| ::.:|.||||||...:|
Mouse   149 KHCKLLCGQQPFDMVEKACRSHGFVVLKEVRFLSLQALYPLLTDPSL-NLHVVHLVRDPRAVFRS 212

  Fly   335 RRH---------RVWCGGN----EDCEDP----RLVCQDLRDDYKTAEVLLLKYPSRFRTVRYED 382
            |.|         .:..|.:    ::.:.|    :::|:...|..|..:.|......|:..:||||
Mouse   213 REHTTIELMVDSHIVLGQHLETIKEEDQPYYAMKIICKSQVDIVKAIQTLPEALQQRYLFLRYED 277

  Fly   383 LSLSPSEMTQDILQFYGLPFDPAVEEFLDTHTKVNIGGVSSTYRDSRSA---PFHWMQDLKPEEI 444
            |..:|...|..:.:|.||.|.|.::.::...|:....|..:.:.::|:|   ...|...|..|::
Mouse   278 LVRAPLAQTTRLYKFVGLDFLPHLQTWVYNVTRGKGMGQHAFHTNARNALNVSQAWRWSLPYEKV 342

  Fly   445 KQIQDVCTEAMDLWGYRRIEN 465
            .|:||.|.|||||.||.::.:
Mouse   343 SQLQDACGEAMDLLGYLQVRS 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31637NP_001285677.1 Sulfotransfer_1 187..459 CDD:304426 87/329 (26%)
Chst4NP_036128.3 Sulfotransfer_3 44..297 CDD:389806 69/270 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834975
Domainoid 1 1.000 91 1.000 Domainoid score I7657
eggNOG 1 0.900 - - E1_299AF
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I4986
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1246608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8874
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10704
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X233
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.860

Return to query results.
Submit another query.