DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31637 and CHST5

DIOPT Version :9

Sequence 1:NP_001285677.1 Gene:CG31637 / 33914 FlyBaseID:FBgn0051637 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_078809.2 Gene:CHST5 / 23563 HGNCID:1973 Length:411 Species:Homo sapiens


Alignment Length:376 Identity:109/376 - (28%)
Similarity:162/376 - (43%) Gaps:90/376 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 PRGGAERLTDMTPETNGTPVRSVVVTSWRSGSTFLGDILNSIPGNFYHYEP------LLDFGIKQ 223
            |.||.:|            |..:|::||||||:|||.:.:..|..||..||      .|..|   
Human    56 PAGGEDR------------VHVLVLSSWRSGSSFLGQLFSQHPDVFYLMEPAWHVWTTLSQG--- 105

  Fly   224 IRDPDDQELAVQNL-KNLLNCDYADMID-YLNFGKTHTYLFEHNTRLW---------DVCREFPR 277
              ......:||::| :::..|| .|:.| |:...:..:..|.     |         ..|..|||
Human   106 --SAATLHMAVRDLMRSIFLCD-MDVFDAYMPQSRNLSAFFN-----WATSRALCSPPACSAFPR 162

  Fly   278 -----------FCWRPAF-LTR-FCRLFPIQSMKTVR-LRLAQAEKLLEDQSLSSVRIVLLVRDP 328
                       .|.|..| |.| .||.:....:|.|| ..|.....||.|.:| ::|||.|||||
Human   163 GTISKQDVCKTLCTRQPFSLAREACRSYSHVVLKEVRFFNLQVLYPLLSDPAL-NLRIVHLVRDP 226

  Fly   329 RGTMQSRR---------HRVWCGGNEDC--EDP--RLVCQDLRDDYKTAEVLLLKYP----SRFR 376
            |..::||.         :.:..|.|...  .||  ||:.:..|...:.||...||.|    .|:|
Human   227 RAVLRSREAAGPILARDNGIVLGTNGKWVEADPHLRLIREVCRSHVRIAEAATLKPPPFLRGRYR 291

  Fly   377 TVRYEDLSLSPSEMTQDILQFYGLPFDPAVEEFLDTHTKVNIGGVS-------STYRDSRSAPFH 434
            .||:|||:..|....:.:..|.||...|.:|.::  |...:..|:.       ::.|::|:....
Human   292 LVRFEDLAREPLAEIRALYAFTGLTLTPQLEAWI--HNITHGSGIGKPIEAFHTSSRNARNVSQA 354

  Fly   435 WMQDLKPEEIKQIQDVCTEAMDLWGYRRIENFNNFSTTQQ---TFDPMVMP 482
            |...|...:|.::|:||..|:.|.|||.:     :|..||   |.| :|:|
Human   355 WRHALPFTKILRVQEVCAGALQLLGYRPV-----YSADQQRDLTLD-LVLP 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31637NP_001285677.1 Sulfotransfer_1 187..459 CDD:304426 94/326 (29%)
CHST5NP_078809.2 Sulfotransfer_3 65..319 CDD:316030 80/265 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144867
Domainoid 1 1.000 84 1.000 Domainoid score I8227
eggNOG 1 0.900 - - E1_299AF
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5104
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1246608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8642
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10704
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X233
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.