DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31637 and CHST4

DIOPT Version :9

Sequence 1:NP_001285677.1 Gene:CG31637 / 33914 FlyBaseID:FBgn0051637 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001159867.1 Gene:CHST4 / 10164 HGNCID:1972 Length:386 Species:Homo sapiens


Alignment Length:337 Identity:87/337 - (25%)
Similarity:144/337 - (42%) Gaps:76/337 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 VVVTSWRSGSTFLGDILNSIPGNFYHYEP--------------LLDFGIKQIRDPDDQELAVQNL 237
            :|::||||||:|:|.:....|..||..||              :|...::.:            :
Human    46 LVLSSWRSGSSFVGQLFGQHPDVFYLMEPAWHVWMTFKQSTAWMLHMAVRDL------------I 98

  Fly   238 KNLLNCDYADMIDYLNFG-KTHTYLFEHNTRLWDVCRE---------------FPR-----FCWR 281
            :.:..||.:....|:..| :..:.||:     |:..|.               .||     .|.:
Human    99 RAVFLCDMSVFDAYMEPGPRRQSSLFQ-----WENSRALCSAPACDIIPQDEIIPRAHCRLLCSQ 158

  Fly   282 PAF--LTRFCRLFPIQSMKTVR-LRLAQAEKLLEDQSLSSVRIVLLVRDPRGTMQSRRH------ 337
            ..|  :.:.||.:....:|.|| ..|.....||:|.|| ::.||.||||||...:||..      
Human   159 QPFEVVEKACRSYSHVVLKEVRFFNLQSLYPLLKDPSL-NLHIVHLVRDPRAVFRSRERTKGDLM 222

  Fly   338 ---RVWCGGNED---CEDP-----RLVCQDLRDDYKTAEVLLLKYPSRFRTVRYEDLSLSPSEMT 391
               |:..|.:|.   .||.     :::||...:.|||.:.|......|:..||||||:.:|...|
Human   223 IDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQT 287

  Fly   392 QDILQFYGLPFDPAVEEFLDTHTK---VNIGGVSSTYRDSRSAPFHWMQDLKPEEIKQIQDVCTE 453
            ..:.:|.||.|.|.::.::...|:   :......:..||:.:....|...|..|::.::|..|.:
Human   288 SRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKACGD 352

  Fly   454 AMDLWGYRRIEN 465
            ||:|.|||.:.:
Human   353 AMNLLGYRHVRS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31637NP_001285677.1 Sulfotransfer_1 187..459 CDD:304426 84/329 (26%)
CHST4NP_001159867.1 Sulfotransfer_1 <168..358 CDD:304426 57/190 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144869
Domainoid 1 1.000 84 1.000 Domainoid score I8227
eggNOG 1 0.900 - - E1_299AF
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5104
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1246608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8642
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10704
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X233
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.