DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31637 and chst5

DIOPT Version :9

Sequence 1:NP_001285677.1 Gene:CG31637 / 33914 FlyBaseID:FBgn0051637 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_017949006.1 Gene:chst5 / 100496630 XenbaseID:XB-GENE-940656 Length:387 Species:Xenopus tropicalis


Alignment Length:357 Identity:90/357 - (25%)
Similarity:160/357 - (44%) Gaps:65/357 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 TPETNGTPVRSVVVTSWRSGSTFLGDILNSIPGNFYHYEPLLDFGIKQIRDPDD-QELAVQNL-K 238
            ||..|......:|:::|||||:|.|.:.:..|..||..||:.....|..|:... .::|.::| :
 Frog    36 TPVKNYQKTHLLVLSTWRSGSSFTGQLFSQHPDVFYLMEPVWHVWSKMNRNSIKLLDMAARDLVR 100

  Fly   239 NLLNCDYADMIDYLNFGKTHTYLFEHNTRLWD---------VCREFPR-----------FCWRPA 283
            ::..||.:....|:...|..:..|:     |:         ||..|.|           .|.:..
 Frog   101 SVFLCDMSVFEAYMPPEKFTSSFFQ-----WETSRALCSPPVCDLFERSDIIPQAHCKLLCPKHP 160

  Fly   284 F--LTRFCRLFPIQSMKTVR-LRLAQAEKLLEDQSLSSVRIVLLVRDPRGTMQSRRH-------- 337
            |  ..:.||.:....:|.|| ..|.....||.|.:: :::|:.||||||...:||:.        
 Frog   161 FNMTEQACRSYSHIVLKEVRFFDLKVLYPLLHDPAI-NLKILHLVRDPRAVFRSRQRTTGALALD 224

  Fly   338 -RVWCGG------NEDCEDPRLVCQDLRDDYKTAEVLLLKY---PSRFRTVRYEDLSLSPSEMTQ 392
             ::..|.      :.|.|..:.:|:.....|:|  |::..:   .||:..|||||::..|.|..:
 Frog   225 TKIVLGAIKSKNWDADYEIIKQICESQVMMYRT--VMMPNFNRLRSRYHMVRYEDIANDPIETAR 287

  Fly   393 DILQFYGLPFDPAVEEFLD--THTKVNIGGVSSTY----RDSRSAPFHWMQDLKPEEIKQIQDVC 451
            .:.||..|.|...::.::.  ||.|    |...::    ||:|:....|...|..:.:.:||::|
 Frog   288 QMYQFANLNFTSKLKTWVHNITHGK----GQGMSFIINSRDARNVSTAWRDSLPFKTVYKIQNIC 348

  Fly   452 TEAMDLWGYRRIENFNNFSTTQQTFDPMVMPP 483
            .||::::|||.::.    .|.|:.....::.|
 Frog   349 KEALNVFGYRILKT----ETEQKNLSYNILLP 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31637NP_001285677.1 Sulfotransfer_1 187..459 CDD:304426 81/320 (25%)
chst5XP_017949006.1 Sulfotransfer_3 46..298 CDD:379204 66/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7322
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I4826
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1246608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9536
Panther 1 1.100 - - O PTHR10704
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X233
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.