DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31637 and chst3

DIOPT Version :9

Sequence 1:NP_001285677.1 Gene:CG31637 / 33914 FlyBaseID:FBgn0051637 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_002939563.2 Gene:chst3 / 100492673 XenbaseID:XB-GENE-993289 Length:462 Species:Xenopus tropicalis


Alignment Length:421 Identity:103/421 - (24%)
Similarity:178/421 - (42%) Gaps:99/421 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 QQLQQ---QQQSSQTAVYNLTATIVDV--LSAQRSRILAEMENFEYPRGGAERLTDMTPETNGTP 183
            :|:.|   :..|:...||..|.:::.:  |.:..|:...::.|.....||.:...:..|:  |..
 Frog    54 KQIPQNIFEANSTDNDVYLETGSLMSLSELDSAFSQFRNKLANVTLQYGGKQPFLEDLPK--GPR 116

  Fly   184 VRSVVVTSWRSGSTFLGDILNSIPGNFYHYEPL------LDF---GIKQI------RDPDDQELA 233
            ...:::.:.|:||:|:|:..|.....||.:|||      :.|   |...:      ||.      
 Frog   117 RHILLMATTRTGSSFVGEFFNQQENIFYLFEPLWHIERTVSFESVGANAVGSAIVYRDV------ 175

  Fly   234 VQNLKNLLNCDYADMIDYLNFGKTHTYLFEHNTRLW------------DVCREFPRFCWRPAFLT 286
               |:.||.||...:..:::....:     |.||..            .||..|.    :..|..
 Frog   176 ---LQQLLLCDLHILESFISPPPEN-----HLTRFMFRRGSSKSLCEDPVCTPFV----KKVFER 228

  Fly   287 RFC---RLFPIQ--------------SMKTVRLR-LAQAEKLLEDQSLSSVRIVLLVRDPRGTMQ 333
            ..|   |..|:.              ::|.||:| |.....|:||..| .:||:.||||||..:.
 Frog   229 YHCKNRRCGPLNMTLAMEACLNKEHVTVKAVRIRQLEYLRTLVEDPRL-DMRIIQLVRDPRAVLA 292

  Fly   334 SR------RHRVWC-----GG----NEDCEDPRLVCQDLRDDYKTAEVLLLKYP----SRFRTVR 379
            ||      ::..|.     |.    .|:.:..:..|:.:|   .:|| |.||.|    .|:..:|
 Frog   293 SRMVAFSGKYESWKKWALEGAAPIPEEEVQKLKGNCESIR---MSAE-LGLKQPEWLRGRYMLIR 353

  Fly   380 YEDLSLSPSEMTQDILQFYGLPFDPAVEEFL--DTHTKVNIGGVSSTYRDSRSAPFHWMQDLKPE 442
            |||::.||.:..:::.:|.|:...|.||:::  :|....:..|:.||.::|......|...:..:
 Frog   354 YEDIARSPLQKAKEMYKFAGISVTPQVEQWIIKNTQASQDSNGIYSTQKNSSEQFEKWRFSIPFK 418

  Fly   443 EIKQIQDVCTEAMDLWGYR---RIENFNNFS 470
            ..:.:||||..||:|:||:   .:|...|.|
 Frog   419 LAQVVQDVCKPAMNLFGYKLANDLETLTNRS 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31637NP_001285677.1 Sulfotransfer_1 187..459 CDD:304426 85/337 (25%)
chst3XP_002939563.2 Sulfotransfer_3 <249..435 CDD:389806 55/190 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7322
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I4826
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1246608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9536
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X233
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.