| Sequence 1: | NP_940892.1 | Gene: | RAB43 / 339122 | HGNCID: | 19983 | Length: | 212 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_523457.1 | Gene: | Rab5 / 33418 | FlyBaseID: | FBgn0014010 | Length: | 219 | Species: | Drosophila melanogaster |
| Alignment Length: | 141 | Identity: | 29/141 - (20%) |
|---|---|---|---|
| Similarity: | 50/141 - (35%) | Gaps: | 38/141 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Human 163 VLENGCYVINVEDCGKNQEKDKVLLRYYESSFPAQSGDGVDGKKLMVNMSPIKDTDIWLNANDKD 227
Human 228 -YSVE-LQKGD-----VSPPD----------QAFFVLHKKSSDFVSFEC----------KNLPGT 265
Human 266 YIGVKDNQLAL 276 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RAB43 | NP_940892.1 | Rab19 | 16..180 | CDD:133267 | 3/16 (19%) |
| Effector region. /evidence=ECO:0000250 | 47..55 | ||||
| Rab5 | NP_523457.1 | Rab5_related | 29..191 | CDD:206653 | 14/63 (22%) |
| Blue background indicates that the domain is not in the aligned region. | |||||