DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB43 and Rab5

DIOPT Version :10

Sequence 1:NP_940892.1 Gene:RAB43 / 339122 HGNCID:19983 Length:212 Species:Homo sapiens
Sequence 2:NP_523457.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster


Alignment Length:141 Identity:29/141 - (20%)
Similarity:50/141 - (35%) Gaps:38/141 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   163 VLENGCYVINVEDCGKNQEKDKVLLRYYESSFPAQSGDGVDGKKLMVNMSPIKDTDIWLNANDKD 227
            :.:..|.:.|:...|       .:|.:.:..: ..|.|||:...|...|  .|.|..| :..|.|
  Fly   138 ITDKDCNIWNINHLG-------TILDFVDEDY-GISIDGVNTAYLYFGM--WKTTFAW-HTEDMD 191

Human   228 -YSVE-LQKGD-----VSPPD----------QAFFVLHKKSSDFVSFEC----------KNLPGT 265
             ||:. |..|.     ..||:          .:|...||....|:..:.          .|:|..
  Fly   192 LYSINYLHFGAPKTWYAVPPEHGRKLEKLARNSFPASHKTCPAFLRHKMTLISPQILKQHNIPYD 256

Human   266 YIGVKDNQLAL 276
            .|..::|::.:
  Fly   257 KITQEENEIMI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB43NP_940892.1 Rab19 16..180 CDD:133267 3/16 (19%)
Effector region. /evidence=ECO:0000250 47..55
Rab5NP_523457.1 Rab5_related 29..191 CDD:206653 14/63 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.