DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9547 and Acox3

DIOPT Version :9

Sequence 1:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_445791.2 Gene:Acox3 / 83522 RGDID:69245 Length:700 Species:Rattus norvegicus


Alignment Length:342 Identity:82/342 - (23%)
Similarity:136/342 - (39%) Gaps:88/342 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 FGS------EEQKQRYLPSMAEGKLIGAFGLTEPNHGSDPAGMETRAKYDSKSKTYILN-----G 189
            |||      .|...:||..:...::.|.|.|||.:|||:...|.|.|.||..::.:||:     .
  Rat   128 FGSTIIGSGSEHHFKYLEKIYNLEIFGCFALTELSHGSNTKAMRTTAHYDPATQEFILHSPDFEA 192

  Fly   190 SKTWITS-APIADVIVVWAK--CEDGKVRG---FLV---DRK--ISGKGLETPKIEGKFSLRASP 243
            :|.|:.: ...|...||:|:  ..||:.||   |||   |.|  :...|:....:..|.......
  Rat   193 AKFWVGNLGKTATHAVVFAQLYTPDGQCRGLHSFLVQIRDPKTLLPMPGVMVGDMGKKLGQNGLD 257

  Fly   244 TGMILMDEVRVPEEQLLP---NVAG---FSGPFSCLNNARYGIAWGALGAA------------ET 290
            .|..:..:||:|.:.||.   ||..   ::.||..:.. |.|.:.|:|.:.            :.
  Rat   258 NGFAMFHKVRIPRQNLLDRTGNVTSEGTYNTPFKDVRQ-RLGASLGSLSSGRISIISISVVNLKL 321

  Fly   291 CVEIARQYTLDRKQFG-----------RPLAANQLI------------QKKLADAITEIALGLQA 332
            .|.||.:::..|:|||           .||...:|:            .|.:...:.|:..|.|:
  Rat   322 AVIIAIRFSATRRQFGPTDKEEIPVLEYPLQQWRLLPYLAAAYALDHFSKTIFLDLIELQRGRQS 386

  Fly   333 CLHVGRLKD--QKLHTPDMISLLKRNNTGKSLDI------ARQMRDMLGANGISDEYHVIRHVIN 389
            ..|..|..:  :::|.        ..:.||.|..      .::.|:..|.:|    |..:.....
  Rat   387 GDHSDRQAELGREIHA--------LASAGKPLASWTAQRGIQECREACGGHG----YLAMNRFGE 439

  Fly   390 LESVN----TYEGTHDI 402
            |.:.|    ||||.:::
  Rat   440 LRNDNDPNCTYEGDNNV 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9547NP_609040.1 GCD 29..417 CDD:173840 82/342 (24%)
CaiA 41..417 CDD:224871 82/342 (24%)
Acox3NP_445791.2 AXO 19..672 CDD:173839 82/342 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.