DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9547 and ACOX3

DIOPT Version :9

Sequence 1:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001362712.1 Gene:ACOX3 / 8310 HGNCID:121 Length:700 Species:Homo sapiens


Alignment Length:365 Identity:83/365 - (22%)
Similarity:145/365 - (39%) Gaps:71/365 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DSAYRSAVSVQSSLAMGAIYDFGSEEQKQRYLPSMAEGKLIGAFGLTEPNHGSDPAGMETRAKYD 179
            ||:..:...:.|.:...|:|..|| |:...|:..:...::.|.|.|||.:|||:...:.|.|.||
Human   114 DSSLAAKYLLHSLVFGSAVYSSGS-ERHLTYIQKIFRMEIFGCFALTELSHGSNTKAIRTTAHYD 177

  Fly   180 SKSKTYILN-----GSKTWI-TSAPIADVIVVWAK-CEDGK----VRGFLV---DRK--ISGKGL 228
            ..::.:|::     .:|.|: .....|...||:|| |..|.    :..|:|   |.|  :...|:
Human   178 PATEEFIIHSPDFEAAKFWVGNMGKTATHAVVFAKLCVPGDQCHGLHPFIVQIRDPKTLLPMPGV 242

  Fly   229 ETPKIEGKFSLRASPTGMILMDEVRVPEEQLLPNVAG------FSGPFSCLNNARYGIAWGALGA 287
            ....|..|........|..:..:||||.:.||..:..      :..||..:.. |:|.:.|:|.:
Human   243 MVGDIGKKLGQNGLDNGFAMFHKVRVPRQSLLNRMGDVTPEGTYVSPFKDVRQ-RFGASLGSLSS 306

  Fly   288 A------------ETCVEIARQYTLDRKQFG-----------RPLAANQLI------------QK 317
            .            :..|.||.:::..|:|||           .|:...:|:            .|
Human   307 GRVSIVSLAILNLKLAVAIALRFSATRRQFGPTEEEEIPVLEYPMQQWRLLPYLAAVYALDHFSK 371

  Fly   318 KLADAITEIALGLQACLHVGRLKD--QKLHTPDMISLLKRNNTGKSLDIARQMRDMLGANGISDE 380
            .|...:.|:..||.:.....|..:  :::|.  :.|..|...:..:....::.|:..|.:|    
Human   372 SLFLDLVELQRGLASGDRSARQAELGREIHA--LASASKPLASWTTQQGIQECREACGGHG---- 430

  Fly   381 YHVIRHVINLESVN----TYEGTHDIHALILGRAITGLAA 416
            |..:..:..|...|    ||||.::|........:.||.|
Human   431 YLAMNRLGVLRDDNDPNCTYEGDNNILLQQTSNYLLGLLA 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9547NP_609040.1 GCD 29..417 CDD:173840 83/365 (23%)
CaiA 41..417 CDD:224871 83/365 (23%)
ACOX3NP_001362712.1 AXO 19..672 CDD:173839 83/365 (23%)
Microbody targeting signal. /evidence=ECO:0000250|UniProtKB:Q63448 698..700
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.