DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9547 and Acox3

DIOPT Version :9

Sequence 1:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_006504259.1 Gene:Acox3 / 80911 MGIID:1933156 Length:755 Species:Mus musculus


Alignment Length:338 Identity:80/338 - (23%)
Similarity:134/338 - (39%) Gaps:70/338 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 LAMGAIYDFGSEEQKQRYLPSMAEGKLIGAFGLTEPNHGSDPAGMETRAKYDSKSKTYILN---- 188
            |..|........|:..:||..:...::.|.|.|||.:|||:...|.|.|.||..::.:||:    
Mouse   126 LVFGTTVFVSGSEKHFKYLEKIYSLEIFGCFALTELSHGSNTKAMRTTAHYDPDTQEFILHSPDF 190

  Fly   189 -GSKTWITS-APIADVIVVWAK--CEDGKVRG---FLV---DRK--ISGKGLETPKIEGKFSLRA 241
             .:|.|:.: ...|...||:|:  ..||:..|   |||   |.|  :...|:....|..|.....
Mouse   191 EAAKFWVGNLGKTATHAVVFAQLYMPDGQCHGLHSFLVQIRDTKTLLPMTGVMVGDIGKKLGQNG 255

  Fly   242 SPTGMILMDEVRVPEEQLLPNVAG------FSGPFSCLNNARYGIAWGALGAA------------ 288
            ...|..:.::||:|.:.||.....      ::.||..:.. |.|.:.|:|.:.            
Mouse   256 LDNGFAMFNKVRIPRQNLLDRTGNITSEGTYNSPFKDVRQ-RLGASLGSLSSGRISIISMSVVNL 319

  Fly   289 ETCVEIARQYTLDRKQFGR------PLAANQLIQKKL------ADAITEIA-------LGLQACL 334
            :..|.||.:::..|.|||.      |:....|.|.::      |.|:...:       :.:|:..
Mouse   320 KLAVSIAIRFSATRCQFGPTDKEEIPVLEYPLQQWRILPYLAAAYALDHFSKTIFMDLIEVQSAR 384

  Fly   335 HVGRLKDQKLHTPDMISLLKRNNTGKSLDI------ARQMRDMLGANGISDEYHVIRHVINLESV 393
            ..|...||:......|..|.  :.||.|..      .::.|:..|.:|    |..:....:|.:.
Mouse   385 LRGDHSDQQAELGREIHALA--SAGKPLASWTAQRGIQECREACGGHG----YLAMNRFGDLRND 443

  Fly   394 N----TYEGTHDI 402
            |    ||||.:::
Mouse   444 NDPNCTYEGDNNV 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9547NP_609040.1 GCD 29..417 CDD:173840 80/338 (24%)
CaiA 41..417 CDD:224871 80/338 (24%)
Acox3XP_006504259.1 AXO 19..663 CDD:173839 80/338 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.