DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9547 and Acads

DIOPT Version :9

Sequence 1:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_071957.1 Gene:Acads / 64304 RGDID:620514 Length:414 Species:Rattus norvegicus


Alignment Length:379 Identity:118/379 - (31%)
Similarity:186/379 - (49%) Gaps:20/379 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QLTEEEVAIRDAFRGYCQAELQPRVKMANRLETFDKKIMEEIGSLGVLGCTI-KGYGCAGVSSVA 103
            :|.|....:|...|.:.:.||.|.....::...|....::::|.||:|...: :....||:..:|
  Rat    35 ELPETHQMLRQTCRDFAEKELVPIAAQLDKEHLFPTSQVKKMGELGLLAMDVPEELSGAGLDYLA 99

  Fly   104 YGLLTREVERVDSAYRSAVSVQSSLAMGAIYDFGSEEQKQRYLPSMAEGKLIGAFGLTEPNHGSD 168
            |.:...|:.|..::....:||.:||.:|.|..|||.:|||:::.....|..||.|.|:||.:|||
  Rat   100 YSIALEEISRGCASTGVIMSVNNSLYLGPILKFGSSQQKQQWITPFTNGDKIGCFALSEPGNGSD 164

  Fly   169 PAGMETRAKYDSKSKTYILNGSKTWITSAPIADVIVVWAKCEDGK----VRGFLVDRKISGKGLE 229
            .....|.|:.:..|  ::|||:|.|||::..|...||:|..:..:    :..|||  .:...||.
  Rat   165 AGAASTTAREEGDS--WVLNGTKAWITNSWEASATVVFASTDRSRQNKGISAFLV--PMPTPGLT 225

  Fly   230 TPKIEGKFSLRASPTGMILMDEVRVPEEQLL--PNVAGFSGPFSCLNNARYGIAWGALGAAETCV 292
            ..|.|.|..:|||.|..::.::.|:|:|.||  |.: ||......|:..|.|||..|||.|:..:
  Rat   226 LGKKEDKLGIRASSTANLIFEDCRIPKENLLGEPGM-GFKIAMQTLDMGRIGIASQALGIAQASL 289

  Fly   293 EIARQYTLDRKQFGRPLAANQLIQKKLADAITEIALGLQAC----LHVGRLKDQKLHTPDMISLL 353
            :.|.:|..:|..||.||...|.||.||||    :||.|::.    .....|||.|.......::.
  Rat   290 DCAVKYAENRHAFGAPLTKLQNIQFKLAD----MALALESARLLTWRAAMLKDNKKPFTKESAMA 350

  Fly   354 KRNNTGKSLDIARQMRDMLGANGISDEYHVIRHVINLESVNTYEGTHDIHALIL 407
            |...:..:..|:.|...:||..|...|....|:..:......||||.:|..|::
  Rat   351 KLAASEAATAISHQAIQILGGMGYVTEMPAERYYRDARITEIYEGTSEIQRLVI 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9547NP_609040.1 GCD 29..417 CDD:173840 118/379 (31%)
CaiA 41..417 CDD:224871 118/378 (31%)
AcadsNP_071957.1 CaiA 35..414 CDD:224871 118/379 (31%)
SCAD_SBCAD 38..410 CDD:173847 117/376 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.