DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9547 and Arc42

DIOPT Version :9

Sequence 1:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_650840.1 Gene:Arc42 / 42364 FlyBaseID:FBgn0038742 Length:405 Species:Drosophila melanogaster


Alignment Length:418 Identity:118/418 - (28%)
Similarity:199/418 - (47%) Gaps:30/418 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSVISKLRPCARRLASTSSKAAAPKFNWQDPLNLESQLTEEEVAIRDAFRGYCQAELQPRVKMAN 68
            |||:::....|||..:....|:.            |.|:|....::.:.|.:...||.......:
  Fly     2 QSVLTRSLCIARRSLNARQIASL------------SALSETHQMLQKSCRDFANNELSGNAAKFD 54

  Fly    69 RLETFDKKIMEEIGSLGVLGCTI-KGYGCAGVSSVAYGLLTREVERVDSAYRSAVSVQSSLAMGA 132
            |...:.:|.:.::|.|||:...| :..|..|:..|||.:...|:.|..::....:||.:||.:|.
  Fly    55 REHLYPEKQIRQMGELGVMAVAIPEELGGTGLDYVAYAIAMEEISRGCASAGVIMSVNNSLYLGP 119

  Fly   133 IYDFGSEEQKQRYLPSMAEGKLIGAFGLTEPNHGSDPAGMETRAKYDSKSKTYILNGSKTWITSA 197
            :..||::.||:.|:.....|:.:|.|.|:||.:|||.....|.|  ..|...::|||:|.|||:|
  Fly   120 LLSFGNDAQKKDYITPFTTGERVGCFALSEPGNGSDAGAASTIA--TDKGDHFVLNGTKAWITNA 182

  Fly   198 PIADVIVVWA----KCEDGKVRGFLVDRKISGKGLETPKIEGKFSLRASPTGMILMDEVRVPEEQ 258
            ..|:..:|:|    :.:...:..|:|.:  :.||....|.|.|..:|.|.|..::.::..||:|.
  Fly   183 FEAEAAIVFATTNKQLKHKGISAFIVPK--ATKGFSLGKKEDKLGIRGSSTCQLIFEDCVVPKEN 245

  Fly   259 LLPNVA-GFSGPFSCLNNARYGIAWGALGAAETCVEIARQYTLDRKQFGRPLAANQLIQKKLADA 322
            :|.... ||......|:..|.|||..|||..:..:|:|..|...|:.||:|:|..|.||:|:|| 
  Fly   246 MLGEPGFGFKIAMQTLDAGRIGIAGQALGIGQAALELAVDYAQKRQAFGKPIAKLQSIQQKIAD- 309

  Fly   323 ITEIALGLQAC----LHVGRLKDQKLHTPDMISLLKRNNTGKSLDIARQMRDMLGANGISDEYHV 383
               ::|.:::.    .....|||||.......::.|...:..:...:.|...:||..|...:...
  Fly   310 ---MSLAMESARLLTWRAAWLKDQKQPYTKEAAMAKLAASEAATLCSHQCIQILGGMGYVTDMAA 371

  Fly   384 IRHVINLESVNTYEGTHDIHALILGRAI 411
            .||..:......||||.:|..|::..:|
  Fly   372 ERHYRDARITEIYEGTSEIQRLVIAGSI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9547NP_609040.1 GCD 29..417 CDD:173840 111/393 (28%)
CaiA 41..417 CDD:224871 110/381 (29%)
Arc42NP_650840.1 CaiA 27..405 CDD:224871 110/381 (29%)
SCAD_SBCAD 29..401 CDD:173847 109/379 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460765
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.