DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9547 and acox3

DIOPT Version :9

Sequence 1:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_998312.1 Gene:acox3 / 406421 ZFINID:ZDB-GENE-040426-2163 Length:692 Species:Danio rerio


Alignment Length:389 Identity:85/389 - (21%)
Similarity:153/389 - (39%) Gaps:110/389 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 YGLLTREVERVDSAYRSAVSVQSSLAMGAIYD-------------FGS------EEQKQRYLPSM 149
            |..:||| |.:.:.::..| :...|.|   ||             ||:      .::..:::..:
Zfish    80 YDFITRE-ELMQNPWKMTV-LNDCLGM---YDWSLCAKYFLNKGMFGATVVNTGSQRHLKFVKDI 139

  Fly   150 AEGKLIGAFGLTEPNHGSDPAGMETRAKYDSKSKTYILN-----GSKTWITS-APIADVIVVWAK 208
            ......|.|.|||.:|||:...:.|.||||..::.:::|     .:|.|:.: ...|...||:|:
Zfish   140 ERMMTFGCFSLTELSHGSNTRALRTTAKYDPNTQEFVINSPDFEAAKFWVGNLGKTATHSVVFAQ 204

  Fly   209 --CEDGKVRG---FLV---DRK--ISGKGLETPKIEGKFSLRASPTGMILMDEVRVPEEQLL--- 260
              ..|||..|   |:|   |.|  ::..|:....:..|........|..:...||:|.|.||   
Zfish   205 LYTPDGKCHGLHSFIVQVRDPKTLLAMPGVMVGDMGKKLGQNGLDNGFAVFHNVRIPRENLLNKT 269

  Fly   261 ----PN---VAGFSGPFSCLNNARYGIAWGALGAA------------ETCVEIARQYTLDRKQFG 306
                |:   |:.|..|     |.|:|.:.|||...            :..|.:|.:::..|:|||
Zfish   270 GDVAPDGQYVSPFKDP-----NKRFGASLGALSGGRVGITRMALVNLKLAVTVAVRFSATRRQFG 329

  Fly   307 R------PLAANQLIQKKLADAITEIALGLQACLHVGRLKDQKLHTPD-MISLLKRNNTGKSLDI 364
            .      |:...||.|.:|...:..:    .|..|.  .|...::..: .:.||.::.:.:..::
Zfish   330 PKEDEEIPVLEYQLQQWRLIPFLAAV----YALEHF--TKSFSMNFVEFQMGLLMKDKSDRQAEL 388

  Fly   365 ARQM----------------------RDMLGANGISDEYHVIRHVINLESVN----TYEGTHDI 402
            .|::                      |:..|.:|    |..:..:.::...|    ||||.:::
Zfish   389 GREIHALSCASKPLGSWTAQRGIQECREACGGHG----YLAMNRLGDMRDDNDPNCTYEGDNNV 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9547NP_609040.1 GCD 29..417 CDD:173840 85/389 (22%)
CaiA 41..417 CDD:224871 85/389 (22%)
acox3NP_998312.1 AXO 11..664 CDD:173839 85/389 (22%)
PLN02312 19..662 CDD:215178 85/389 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.