DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9547 and Acox57D-p

DIOPT Version :9

Sequence 1:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001286677.1 Gene:Acox57D-p / 37445 FlyBaseID:FBgn0034628 Length:677 Species:Drosophila melanogaster


Alignment Length:346 Identity:76/346 - (21%)
Similarity:130/346 - (37%) Gaps:90/346 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 EQKQRYLPSMAEGKLIGAFGLTEPNHGSDPAGMETRAKYDSKSKTYILN----GSKTWITSA--- 197
            ||.:.:...:...::.|.:..||..||:...|:||||.:|.|:..::||    .|..|....   
  Fly   138 EQYEEFGKRVELFEICGTYAQTELGHGTYLRGLETRADFDRKTDQFVLNTPNISSYKWWPGGLGH 202

  Fly   198 ------PIADVIVVWAKCEDGKVRG---FLV-----DRKISGKGLETPKIEGKFSLRASPTGMIL 248
                  .:|.:.:      ||..:|   |.:     |......|:....|..|........|.:.
  Fly   203 SSNHCLVMAQLYI------DGDCKGPHMFFIQVRDEDTHEPLPGVHIGDIGKKMGFIGVNNGFLG 261

  Fly   249 MDEVRVPEEQLLPNVAG-------FSGPFSCL--------------NNARYGIAWGALGAAETCV 292
            :..||:|..::|...|.       .|.|.:.|              |||      ..|.:|.|  
  Fly   262 LKNVRIPRTRMLMRHAQVKADGSYVSSPTNVLTYFAMVRTRCVIAKNNA------VMLASAAT-- 318

  Fly   293 EIARQYTLDRKQFGRPLAANQLIQKKLADAIT-------EIALGL---QACLHVGRLKDQKL--- 344
             ||.:|:..|:|  .|:..|:. :.::.|.:|       |||..:   :|..::..|.|..:   
  Fly   319 -IATRYSAVRRQ--SPINPNER-EPQIMDHVTQQMKLFPEIATSVAYRKAGDYLWNLYDVTIEDI 379

  Fly   345 ------HTPDMISLLKRNNTGKSLDIA---RQMRDMLGANGISDEYHVIRHVINLESVNTYEGTH 400
                  ..|::.||........|:|.|   .::|...|.:|.....::....::..:..||||.:
  Fly   380 ENGKYERLPELHSLSCALKVTCSMDSASGVEKLRLACGGHGFLTSSNMSSIYVSATAACTYEGEN 444

  Fly   401 DIHALILGR--------AITG 413
            .:..|.:||        |:||
  Fly   445 TVLLLQIGRFLMKTWRAALTG 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9547NP_609040.1 GCD 29..417 CDD:173840 76/346 (22%)
CaiA 41..417 CDD:224871 76/346 (22%)
Acox57D-pNP_001286677.1 ACAD 14..653 CDD:299127 76/346 (22%)
PLN02443 16..677 CDD:178062 76/346 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460784
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.