DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9547 and ACADS

DIOPT Version :9

Sequence 1:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_000008.1 Gene:ACADS / 35 HGNCID:90 Length:412 Species:Homo sapiens


Alignment Length:413 Identity:124/413 - (30%)
Similarity:195/413 - (47%) Gaps:39/413 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RLASTSSKAAAPKFNWQD--PLNLESQLTEEEVAIRDAFRGYCQAELQPRVKMANRLETFDKKIM 78
            |.:..:.:|..|: .|:.  .:....:|.|....:....|.:.:.||.|.....::...|....:
Human     8 RASGPARRALCPR-AWRQLHTIYQSVELPETHQMLLQTCRDFAEKELFPIAAQVDKEHLFPAAQV 71

  Fly    79 EEIGSLGVLGCTI-KGYGCAGVSSVAYGLLTREVERVDSAYRSAVSVQSSLAMGAIYDFGSEEQK 142
            :::|.||:|...: :..|.||:..:||.:...|:.|..::....:||.:||.:|.|..|||:|||
Human    72 KKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNNSLYLGPILKFGSKEQK 136

  Fly   143 QRYLPSMAEGKLIGAFGLTEPNHGSDPAGMETRAKYDSKSKTYILNGSKTWITSAPIADVIVVWA 207
            |.::.....|..||.|.|:||.:|||.....|.|:.:..|  ::|||:|.|||:|..|...||:|
Human   137 QAWVTPFTSGDKIGCFALSEPGNGSDAGAASTTARAEGDS--WVLNGTKAWITNAWEASAAVVFA 199

  Fly   208 KCEDGKVRGFLVDRKISGKGLE-------TP-----KIEGKFSLRASPTGMILMDEVRVPEEQLL 260
            .          .||.:..||:.       ||     |.|.|..:|.|.|..::.::.|:|::.:|
Human   200 S----------TDRALQNKGISAFLVPMPTPGLTLGKKEDKLGIRGSSTANLIFEDCRIPKDSIL 254

  Fly   261 --PNVAGFSGPFSCLNNARYGIAWGALGAAETCVEIARQYTLDRKQFGRPLAANQLIQKKLADAI 323
              |.: ||......|:..|.|||..|||.|:|.::.|..|..:|..||.||...|:||.||||  
Human   255 GEPGM-GFKIAMQTLDMGRIGIASQALGIAQTALDCAVNYAENRMAFGAPLTKLQVIQFKLAD-- 316

  Fly   324 TEIALGLQAC----LHVGRLKDQKLHTPDMISLLKRNNTGKSLDIARQMRDMLGANGISDEYHVI 384
              :||.|::.    .....|||.|.......::.|...:..:..|:.|...:||..|...|....
Human   317 --MALALESARLLTWRAAMLKDNKKPFIKEAAMAKLAASEAATAISHQAIQILGGMGYVTEMPAE 379

  Fly   385 RHVINLESVNTYEGTHDIHALIL 407
            ||..:......||||.:|..|::
Human   380 RHYRDARITEIYEGTSEIQRLVI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9547NP_609040.1 GCD 29..417 CDD:173840 121/400 (30%)
CaiA 41..417 CDD:224871 120/386 (31%)
ACADSNP_000008.1 CaiA 33..412 CDD:224871 120/387 (31%)
SCAD_SBCAD 36..408 CDD:173847 119/384 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.