DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9547 and CG9527

DIOPT Version :9

Sequence 1:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001137800.1 Gene:CG9527 / 33898 FlyBaseID:FBgn0031813 Length:724 Species:Drosophila melanogaster


Alignment Length:422 Identity:102/422 - (24%)
Similarity:174/422 - (41%) Gaps:115/422 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 AELQPRVKMANRLE--TFDKK---IMEEIGS---LGVLGCTIKGYGCAGVSSVAYGLLTREVERV 114
            ::|:...:|||:.:  .::::   :.|.:|:   |...|..|..|..:  :||.:||.|      
  Fly   100 SDLERTREMANKRQHLLWEQQFYGVNEYLGTPHLLLAFGQAIFSYDFS--TSVKFGLST------ 156

  Fly   115 DSAYRSAVSVQSSLAMGAIYDFGSEEQKQRYLPSMAEGKLIGAFGLTEPNHGSDPAGMETRAKYD 179
             ..:.|.:....|..:|            :|:..:|:.:::||:.|||.:||::..||.|||.||
  Fly   157 -GMFPSTLVSNGSGRLG------------KYVAKIADNRILGAYALTEISHGTNALGMRTRATYD 208

  Fly   180 SKSKTYILN-----GSKTWI-------TSAPIADVIVVWAK--CEDGKVRG---FLV---DRK-- 222
            .|.:.:|::     .:|.|:       |.|      :|:|:  ..|.|.:|   |||   |.:  
  Fly   209 VKRQEFIIHTPDFEAAKCWVGNLGKTCTHA------IVYAQLYVPDDKHQGLQAFLVPIRDERTL 267

  Fly   223 ISGKGLETPKIEGKFSLRASPTGMILMDEVRVPEEQLLPNVAGFSGPFSCLNN---------ARY 278
            :...|:....:..|..|.....|.::.::.|:|:..||..    :|......|         .|.
  Fly   268 LPFPGVTVGDMGEKIGLNGIDNGFVMFNQYRIPKANLLSK----TGDIDAQGNYTSKIKDERKRL 328

  Fly   279 GIAWGALG------------AAETCVEIARQYTLDRKQFGR-------PLAANQLIQKKLADAI- 323
            |.:.|||.            |....|.||.:|...|:|||.       |:...|..|.:|...: 
  Fly   329 GASLGALSVGRVNITAITYVALSKAVTIATRYAASRRQFGPTNSPAEWPVIEYQSQQYRLIPHLA 393

  Fly   324 TEIALGLQACLHVGR------LK----------DQKLHTPDMISLLKRNNTGKSLDIARQMRDML 372
            |.|||.: |.|.:|:      :|          ..::|.  :.|.||...|..:.|..::.|:..
  Fly   394 TTIALRV-ATLWIGKENVDLTMKGFTGEDTSQAGMEIHA--ISSALKPVATWAARDGIQECREAC 455

  Fly   373 GANGI--SDEYHVIRHVINLESVN-TYEGTHD 401
            |.:|.  |.....:|   |....| ||||.::
  Fly   456 GGHGYLKSSGLGELR---NDNDANCTYEGENN 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9547NP_609040.1 GCD 29..417 CDD:173840 102/422 (24%)
CaiA 41..417 CDD:224871 102/422 (24%)
CG9527NP_001137800.1 ACAD 52..694 CDD:299127 102/422 (24%)
PLN02312 56..682 CDD:215178 102/422 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460787
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.