DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9547 and Acad9

DIOPT Version :9

Sequence 1:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_861433.2 Gene:Acad9 / 294973 RGDID:727973 Length:625 Species:Rattus norvegicus


Alignment Length:402 Identity:125/402 - (31%)
Similarity:196/402 - (48%) Gaps:45/402 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QLTEEEVAIRDAFRGYCQAELQPRVKMANRLETFDKKIMEE----------IGSLGVLGCTI-KG 93
            ::::||::..:.|.|       |..|..|. |...:||.:|          :.|||:.|..: :.
  Rat    62 EVSQEELSEINQFVG-------PLEKFFNE-EVDSRKIDQEGKIPADTLAKLKSLGLFGIQVPEE 118

  Fly    94 YGCAGVSSVAYGLLTREVERVDSAYRSAVSVQSSLAMGAIYDFGSEEQKQRYLPSMAEGKLIGAF 158
            ||..|:|:..|..| .|:..:|::....::...::.:..|...|:||||.:|||.::.|:.|.||
  Rat   119 YGGLGLSNTMYARL-GEIISMDASITVTLAAHQAIGLKGIILVGNEEQKAKYLPKLSSGEHIAAF 182

  Fly   159 GLTEPNHGSDPAGMETRAKYDSKSKTYILNGSKTWITSAPIADVIVVWAKCE----DG----KVR 215
            .||||..|||.|.::|||......|.::|||||.|||:..:|::..|:||.|    ||    |:.
  Rat   183 CLTEPASGSDAASIQTRATLSEDKKYFVLNGSKVWITNGGLANIFTVFAKTEVVDSDGSIKDKMT 247

  Fly   216 GFLVDRKISGKGLETPKIEGKFSLRASPTGMILMDEVRVPEEQLLPNV-AGFSGPFSCLNNARYG 279
            .|:|:|...  |:...|.|.|..:|.|.|..:..:..|||.|.:|..| .||....:.||:.|:.
  Rat   248 AFIVERDFG--GITNGKPEDKLGIRGSNTCEVHFENTRVPVENVLGEVGGGFKVAMNILNSGRFS 310

  Fly   280 IAWGALGAAETCVEIARQYTLDRKQFGRPLAANQLIQKKLA-DAITEIALGLQACLHVGRLKDQK 343
            :.....|..:..:|...:|...||||.|.|:...|||:|.| .|.....:...|.|..|.| ||.
  Rat   311 MGSAVAGMLKKLIEQTAEYACTRKQFNRNLSEFGLIQEKFALMAQKAYVMESMAYLTSGML-DQP 374

  Fly   344 LHTPD------MISLLKRNNTGKSLDIARQMRDMLGANGISDEYHVIRHVINLESVNTYEGTHDI 402
             ..||      |:.:.......:.:..|.|   :||.:|...:|...|.:.:...:..:|||::|
  Rat   375 -GFPDCSIEAAMVKVFSSEAAWQCVSEALQ---ILGGSGYMKDYPYERMLRDARILLIFEGTNEI 435

  Fly   403 HALILGRAITGL 414
            ..|.:  |:|||
  Rat   436 LRLFI--ALTGL 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9547NP_609040.1 GCD 29..417 CDD:173840 125/402 (31%)
CaiA 41..417 CDD:224871 125/401 (31%)
Acad9NP_861433.2 VLCAD 42..449 CDD:173850 125/402 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.