DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9547 and ACAD9

DIOPT Version :9

Sequence 1:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_054768.2 Gene:ACAD9 / 28976 HGNCID:21497 Length:621 Species:Homo sapiens


Alignment Length:459 Identity:127/459 - (27%)
Similarity:202/459 - (44%) Gaps:103/459 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RRLASTSSKAAA------------------PKFNWQDPLN----------------LESQLTEEE 45
            |||..||....|                  |:.: ||.||                ::|:..::|
Human    27 RRLLRTSPPVRAFAKELFLGKIKKKEVFPFPEVS-QDELNEINQFLGPVEKFFTEEVDSRKIDQE 90

  Fly    46 VAIRDAFRGYCQAELQPRVKMANRLETFDKKIMEEIGSLGVLGCTI-KGYGCAGVSSVAYGLLTR 109
            ..|.|                    ||     :|::.|||:.|..: :.||..|.|:..|..| .
Human    91 GKIPD--------------------ET-----LEKLKSLGLFGLQVPEEYGGLGFSNTMYSRL-G 129

  Fly   110 EVERVDSAYRSAVSVQSSLAMGAIYDFGSEEQKQRYLPSMAEGKLIGAFGLTEPNHGSDPAGMET 174
            |:..:|.:....::...::.:..|...|:||||.:|||.:|.|:.|.||.||||..|||.|.:.:
Human   130 EIISMDGSITVTLAAHQAIGLKGIILAGTEEQKAKYLPKLASGEHIAAFCLTEPASGSDAASIRS 194

  Fly   175 RAKYDSKSKTYILNGSKTWITSAPIADVIVVWAKCE----DG----KVRGFLVDRKISGKGLETP 231
            ||......|.|||||||.|||:..:|::..|:||.|    ||    |:..|:|:|...  |:...
Human   195 RATLSEDKKHYILNGSKVWITNGGLANIFTVFAKTEVVDSDGSVKDKITAFIVERDFG--GVTNG 257

  Fly   232 KIEGKFSLRASPTGMILMDEVRVPEEQLLPNVA-GFSGPFSCLNNARYGIAWGALGAAETCVEIA 295
            |.|.|..:|.|.|..:..:..::|.|.:|..|. ||....:.||:.|:.:.....|..:..:|:.
Human   258 KPEDKLGIRGSNTCEVHFENTKIPVENILGEVGDGFKVAMNILNSGRFSMGSVVAGLLKRLIEMT 322

  Fly   296 RQYTLDRKQFGRPLAANQLIQKKLA---------DAITEIALGLQACLHVGRLKDQKLHTPD--- 348
            .:|...||||.:.|:...|||:|.|         :::|.:..|         :.||. ..||   
Human   323 AEYACTRKQFNKRLSEFGLIQEKFALMAQKAYVMESMTYLTAG---------MLDQP-GFPDCSI 377

  Fly   349 ---MISLLKRNNTGKSLDIARQMRDMLGANGISDEYHVIRHVINLESVNTYEGTHDIHALILGRA 410
               |:.:.......:.:..|.|   :||..|.:.:|...|.:.:...:..:|||::|..:.:  |
Human   378 EAAMVKVFSSEAAWQCVSEALQ---ILGGLGYTRDYPYERILRDTRILLIFEGTNEILRMYI--A 437

  Fly   411 ITGL 414
            :|||
Human   438 LTGL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9547NP_609040.1 GCD 29..417 CDD:173840 120/427 (28%)
CaiA 41..417 CDD:224871 115/399 (29%)
ACAD9NP_054768.2 VLCAD 38..445 CDD:173850 122/448 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.