DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9547 and Acox2

DIOPT Version :9

Sequence 1:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_665713.2 Gene:Acox2 / 252898 RGDID:628684 Length:681 Species:Rattus norvegicus


Alignment Length:338 Identity:75/338 - (22%)
Similarity:124/338 - (36%) Gaps:65/338 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 LAMGAIYDFGSEEQKQRYLPSMAEGKLIGAFGLTEPNHGSDPAGMETRAKYDSKSKTYILN---- 188
            :||.||...||:||..::.......::|..:..||..||:...|:||.|.||...:.::::    
  Rat   121 VAMNAIRSLGSDEQIAKWGQLCKNFQIITTYAQTELGHGTYLQGLETEATYDEARQEFVIHSPTM 185

  Fly   189 -GSKTW-------ITSAPIADVIVVWAKCEDGK--VRGFLVD-RKISG----KGLETPKIEGKFS 238
             .:|.|       :|.|    |::....|...:  :..|:|. |.:..    .|:....|..|..
  Rat   186 TSTKWWPGDLGWSVTHA----VVLAQLTCLGVRHGMHAFIVPIRSLEDHTPLPGITVGDIGPKMG 246

  Fly   239 LRASPTGMILMDEVRVPEEQLLPNVAGF--SGPFSCLNNARYG-----------IAWGALGAAET 290
            |.....|.:.::.||||.|.:|...|..  .|.:..|...:..           :..|.|.:.:.
  Rat   247 LEHIDNGFLQLNHVRVPRENMLSRFAEVLPDGTYQRLGTPQSNYLGMLVTRVQLLCKGILPSLQK 311

  Fly   291 CVEIARQYTLDRKQFG-RP------LAANQLIQKKLADAITEIALGLQACLHVGRLKDQKLHTPD 348
            ...||.:|::.|.|.. ||      :...|..|:||..     .|.:....|.......:.....
  Rat   312 ACIIATRYSVIRHQSRLRPSDPEAKILEYQTQQQKLLP-----QLAVSYAFHFTATSLSEFFHSS 371

  Fly   349 MISLLKRN----------NTGKS---LDIARQ----MRDMLGANGISDEYHVIRHVINLESVNTY 396
            ..::|||:          :||..   .|...|    .|...|.:|.|....:...|....:..||
  Rat   372 YSAILKRDFSLLPELHALSTGMKATFADFCAQGAEICRRACGGHGYSKLSGLPTLVARATASCTY 436

  Fly   397 EGTHDIHALILGR 409
            ||.:.:..|.:.|
  Rat   437 EGENTVLYLQVAR 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9547NP_609040.1 GCD 29..417 CDD:173840 75/338 (22%)
CaiA 41..417 CDD:224871 75/338 (22%)
Acox2NP_665713.2 AXO 20..655 CDD:173839 75/338 (22%)
Microbody targeting signal. /evidence=ECO:0000255 679..681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.