DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9547 and Egm

DIOPT Version :10

Sequence 1:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_310635.5 Gene:Egm / 1271781 VectorBaseID:AGAMI1_005470 Length:617 Species:Anopheles gambiae


Alignment Length:36 Identity:12/36 - (33%)
Similarity:21/36 - (58%) Gaps:3/36 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LQRSEKYFRRASEYLPE-RWLSERPADVPSAKDSNP 62
            |..|:|  :|::.:||. |.|..|.:::..||..:|
Mosquito   277 LLESKK--KRSASFLPSFRDLKHRLSNMKRAKSPSP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9547NP_609040.1 GCD 29..417 CDD:173840 11/35 (31%)
EgmXP_310635.5 None

Return to query results.
Submit another query.