DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31638 and CCDC102B

DIOPT Version :9

Sequence 1:NP_723186.2 Gene:CG31638 / 33910 FlyBaseID:FBgn0051638 Length:704 Species:Drosophila melanogaster
Sequence 2:XP_016881462.1 Gene:CCDC102B / 79839 HGNCID:26295 Length:527 Species:Homo sapiens


Alignment Length:483 Identity:186/483 - (38%)
Similarity:269/483 - (55%) Gaps:59/483 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 YGETEWEARESQRQRELHEARARAAQMEKTMKWWSDCTANWREKWSKVRNERNKAREESKQLSLK 102
            |...:|:..|..|.|||.|.:||||||||||:|||||||||||||||||.|||.||||.:||.:|
Human    62 YNTNKWDICEELRLRELEEVKARAAQMEKTMRWWSDCTANWREKWSKVRAERNSAREEGRQLRIK 126

  Fly   103 LDGVMKEAHSLKR------EKNDLELQITQLKK-----EMEKVHTLMMKHAGQFHRA-------- 148
            |:..|||..:||:      :|..||.::||..|     |....||...:.:.|.|.:        
Human   127 LEMAMKELSTLKKKQSLPPQKEALEAKVTQDLKLPGFVEESCEHTDQFQLSSQMHESIREYLVKR 191

  Fly   149 --DTSEDAEANGRDANCSPDISSDGLKNINSEDGLV---TKLPNDVK-DLDIEEFAMKGAMPKHL 207
              .|.||..                    |.|.|:|   .||..::| :||..:....|......
Human   192 QFSTKEDTN--------------------NKEQGVVIDSLKLSEEMKPNLDGVDLFNNGGSGNGE 236

  Fly   208 TELDEAAAAEEKRLIQQLSKDDFDEDYLLQKISMLQLRLDEAQKTLQAERDEKLELHKSIEKLTL 272
            |:......|....|..:::           :||.||:.|||.||.|..||:.:..|.|.||:|..
Human   237 TKTGLRLKAINLPLENEVT-----------EISALQVHLDEFQKILWKEREMRTALEKEIERLES 290

  Fly   273 EIQDVRGRQEEMRSAKQEAVRELLTLQEQHRAEMRIVNNSLQEEIAARENLERRLTELRTELEHL 337
            .:...:.:.||::.:|.:.|:|...|..||..||:.::.:::||..::.:.:|.:.|||.|||.|
Human   291 ALSLWKWKYEELKESKPKNVKEFDILLGQHNDEMQELSGNIKEESKSQNSKDRVICELRAELERL 355

  Fly   338 QAENASEWGKRERLESEKLAMERDNKKLRAELRDYQERSDRKCRPMQAN--DVELRALQQELSER 400
            ||||.|||.|||.||.||..:||:|::|:.::::.:|..|:|.| :.||  ..:.:..|.:|.|:
Human   356 QAENTSEWDKREILEREKQGLERENRRLKIQVKEMEELLDKKNR-LSANSQSPDFKMSQIDLQEK 419

  Fly   401 NKEISEVKMSHAKLKKLLAETNTELGHAVRRAEQYEAEVKRLRQRVEELKRELAGAEDELDSAVN 465
            |:|:..::.::.||.:.......||.||..|.:|.|||||:||.||||||:.|...|||||.::|
Human   420 NQELLNLQHAYYKLNRQYQANIAELTHANNRVDQNEAEVKKLRLRVEELKQGLNQKEDELDDSLN 484

  Fly   466 QVRRLQRSNDELVGQTEGLQVQIQHLQN 493
            |:|:||||.||...:.|.|:.:::||||
Human   485 QIRKLQRSLDEEKERNENLETELRHLQN 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31638NP_723186.2 DUF4201 284..457 CDD:290581 69/174 (40%)
Ax_dynein_light <300..369 CDD:287215 32/68 (47%)
RILP-like <312..448 CDD:304877 56/137 (41%)
CCDC102BXP_016881462.1 KASH_CCD 345..511 CDD:291334 75/166 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28K4K
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1304833at2759
OrthoFinder 1 1.000 - - FOG0005832
OrthoInspector 1 1.000 - - otm40788
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.