DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31638 and zip

DIOPT Version :9

Sequence 1:NP_723186.2 Gene:CG31638 / 33910 FlyBaseID:FBgn0051638 Length:704 Species:Drosophila melanogaster
Sequence 2:NP_523860.2 Gene:zip / 38001 FlyBaseID:FBgn0265434 Length:2056 Species:Drosophila melanogaster


Alignment Length:548 Identity:122/548 - (22%)
Similarity:225/548 - (41%) Gaps:117/548 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ELHEARARAAQMEKTMKWWSDCTANWREKWSKVRNERNKAREESKQLSLKLDGVMKE-------- 109
            ||...|.:..::||..|.:....|..:....::..||:.|..|:::...|:..|.:|        
  Fly  1518 ELEAQRTKVLELEKKQKNFDKILAEEKAISEQIAQERDTAEREAREKETKVLSVSRELDEAFDKI 1582

  Fly   110 ---------------------------AHSLKREKNDLELQITQLKKEMEKVHTLMMKHAGQFHR 147
                                       .|.|::.|..||.|:.:||.:.|::             
  Fly  1583 EDLENKRKTLQNELDDLANTQGTADKNVHELEKAKRALESQLAELKAQNEEL------------- 1634

  Fly   148 ADTSEDAEANGRDANCSPDISSDGLKN------INSEDGLVTKLPNDVKDL-DIEEFAMKGAMPK 205
                ||......||....:::...|::      :..|:|...|....||.| |:|          
  Fly  1635 ----EDDLQLTEDAKLRLEVNMQALRSQFERDLLAKEEGAEEKRRGLVKQLRDLE---------- 1685

  Fly   206 HLTELDE------AAAAEEKRLIQQLSK--------DDFDEDYLLQKISMLQLRLDEAQKTLQAE 256
              |||||      ||.|.:|:|...|.:        :...|| .|:....||.::.:|.:..:..
  Fly  1686 --TELDEERKQRTAAVASKKKLEGDLKEIETTMEMHNKVKED-ALKHAKKLQAQVKDALRDAEEA 1747

  Fly   257 RDEKLELH----------KSIEKLTLEI-QDVRGRQEEMRSAKQE-----------AVRELLTLQ 299
            :..|.||.          |::|...|:: :|:...:...|:|:.|           |.:..|.:.
  Fly  1748 KAAKEELQALSKEAERKVKALEAEVLQLTEDLASSERARRAAETERDELAEEIANNANKGSLMID 1812

  Fly   300 EQHRAEMRI--VNNSLQEEIAARENLERRLTELRTELEHLQAENASEWGKRERLESEKLAMERDN 362
            |:.|.|.||  :...|:||.:..|.|..|..:.:.::|.|..|.|:|....::.|:.:..:||.|
  Fly  1813 EKRRLEARIATLEEELEEEQSNSEVLLDRSRKAQLQIEQLTTELANEKSNSQKNENGRALLERQN 1877

  Fly   363 KKLRAELRDYQERSDRKCRPMQAN-DVELRALQQELSERNKEISEVKMSHAKLKKLLAETNTELG 426
            |:|:|:|.:.:.....|.:...|. :.::..|:::|....||....:.::.|:.|.:.|....:.
  Fly  1878 KELKAKLAEIETAQRTKVKATIATLEAKIANLEEQLENEGKERLLQQKANRKMDKKIKELTMNIE 1942

  Fly   427 HAVRRAEQYEAEVKRLRQRVEELKRELAGAEDELDSAVNQVRRLQRSNDELVGQTEGLQVQIQHL 491
            ...|..:|::.::.:|..|::.|||.|...|:||.....|.|:.||..::::...|.:..:|..|
  Fly  1943 DERRHVDQHKEQMDKLNSRIKLLKRNLDETEEELQKEKTQKRKYQRECEDMIESQEAMNREINSL 2007

  Fly   492 QNRRAPSPQLRGMGGVQLRNKIAVELPN 519
            :.:      ||..||:.|.:......|:
  Fly  2008 KTK------LRRTGGIGLSSSRLTGTPS 2029

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31638NP_723186.2 DUF4201 284..457 CDD:290581 46/186 (25%)
Ax_dynein_light <300..369 CDD:287215 23/70 (33%)
RILP-like <312..448 CDD:304877 32/136 (24%)
zipNP_523860.2 Myosin_N 80..117 CDD:280832
Myosin_head 133..854 CDD:278492
MYSc_Myh2_insects_mollusks 145..854 CDD:276876
Myosin_tail_1 931..2011 CDD:279860 116/528 (22%)
Prefoldin 1431..1515 CDD:298833
FAM76 <1847..1926 CDD:292665 19/78 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466227
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.