DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31638 and F53F10.1

DIOPT Version :9

Sequence 1:NP_723186.2 Gene:CG31638 / 33910 FlyBaseID:FBgn0051638 Length:704 Species:Drosophila melanogaster
Sequence 2:NP_491236.1 Gene:F53F10.1 / 171959 WormBaseID:WBGene00018763 Length:241 Species:Caenorhabditis elegans


Alignment Length:275 Identity:78/275 - (28%)
Similarity:124/275 - (45%) Gaps:73/275 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RYGETEWEARESQRQRELHEARARAAQMEKTMKWWSDCTANWREKWSKVRNERNKAREESKQLSL 101
            |...|:|:..|..|..||.|||.|||||||||:|||.|||:||.:||.||:|||:||||::.|.|
 Worm    30 RCQHTDWDICERIRLGELKEARDRAAQMEKTMRWWSSCTADWRNRWSAVRDERNRAREEAETLRL 94

  Fly   102 KLDGVMKEAHSLKREKNDLELQITQLKKEMEKVHTLMMKHAGQFHRADTSEDAEANGRDANCSPD 166
            ..|.:::|...|                            |.|.:..|:..|...  .:.:..|:
 Worm    95 NYDLLLEEKRFL----------------------------AEQLYHVDSESDEPK--LEISQKPE 129

  Fly   167 ISSDGLKNINSEDGLVTKLPNDVKDLDIEEFAMKGAMPKHLTELDEAAAAEEKRLIQQLSKDDFD 231
            |  ||.|. |:....:..:..|...:.::.:                :||:.:.::::.|.|:  
 Worm   130 I--DGTKR-NAVVQTIHSISCDPPSILVKSY----------------SAAQIEAVLREPSVDE-- 173

  Fly   232 EDYLLQKISMLQLRLDEAQKTLQAE----RDEKLELHKSIEKLTLE---IQDVRGRQEEMRSAKQ 289
                    ..::....:..:.|:||    :|:..||:|..||:..:   |||:|.|.:.|.    
 Worm   174 --------PPVETTKSDINEELKAENEFLKDQANELNKCREKIETDGKTIQDLRLRIQSME---- 226

  Fly   290 EAVRELLTLQEQHRA 304
               |||:..:...||
 Worm   227 ---RELMAAKNSKRA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31638NP_723186.2 DUF4201 284..457 CDD:290581 6/21 (29%)
Ax_dynein_light <300..369 CDD:287215 2/5 (40%)
RILP-like <312..448 CDD:304877
F53F10.1NP_491236.1 SMC_prok_A <46..>241 CDD:274009 73/259 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28K4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005832
OrthoInspector 1 1.000 - - oto18454
orthoMCL 1 0.900 - - OOG6_108934
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3433
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.