DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phf5a and Phf5a

DIOPT Version :9

Sequence 1:NP_609038.1 Gene:Phf5a / 33909 FlyBaseID:FBgn0031822 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_081013.1 Gene:Phf5a / 68479 MGIID:2156864 Length:110 Species:Mus musculus


Alignment Length:109 Identity:105/109 - (96%)
Similarity:106/109 - (97%) Gaps:0/109 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKHHPDLIFCRKQPGVAIGRLCEKDDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPG 65
            ||||||||||||||.||||||||||.|||||||||||||||||||||||||||||||||||||||
Mouse     1 MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPG 65

  Fly    66 VSDAYYCKSCTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKQ 109
            ||||||||.||||||||||||||||||||||||||||||||||:
Mouse    66 VSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phf5aNP_609038.1 PHF5 1..104 CDD:397635 99/102 (97%)
Phf5aNP_081013.1 PHF5 1..104 CDD:397635 99/102 (97%)
Interaction with SF3B1 AND SF3B3. /evidence=ECO:0000250|UniProtKB:Q7RTV0 35..51 15/15 (100%)
Interaction with SF3B3. /evidence=ECO:0000250|UniProtKB:Q7RTV0 79..82 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833703
Domainoid 1 1.000 224 1.000 Domainoid score I2555
eggNOG 1 0.900 - - E1_KOG1705
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7151
Inparanoid 1 1.050 234 1.000 Inparanoid score I3404
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53688
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004100
OrthoInspector 1 1.000 - - oto93984
orthoMCL 1 0.900 - - OOG6_102593
Panther 1 1.100 - - LDO PTHR13120
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R611
SonicParanoid 1 1.000 - - X2842
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.