DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phf5a and phf-5

DIOPT Version :9

Sequence 1:NP_609038.1 Gene:Phf5a / 33909 FlyBaseID:FBgn0031822 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001022909.1 Gene:phf-5 / 3564851 WormBaseID:WBGene00004016 Length:110 Species:Caenorhabditis elegans


Alignment Length:110 Identity:97/110 - (88%)
Similarity:105/110 - (95%) Gaps:0/110 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKHHPDLIFCRKQPGVAIGRLCEKDDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPG 65
            ||||||||||||||||:||||||||.||:||||||:||||||||||:||||||||||||||||.|
 Worm     1 MAKHHPDLIFCRKQPGIAIGRLCEKCDGRCVICDSHVRPCTLVRICEECNYGSYQGRCVICGGAG 65

  Fly    66 VSDAYYCKSCTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKQN 110
            ||||||||.|||.|||||||||||||||:||||||||||:|.|::
 Worm    66 VSDAYYCKECTILEKDRDGCPKIVNLGSAKTDLFYERKKFGSKKS 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phf5aNP_609038.1 PHF5 1..104 CDD:397635 93/102 (91%)
phf-5NP_001022909.1 PHF5 2..104 CDD:281635 92/101 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157626
Domainoid 1 1.000 215 1.000 Domainoid score I1577
eggNOG 1 0.900 - - E1_KOG1705
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7151
Inparanoid 1 1.050 221 1.000 Inparanoid score I2284
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53688
OrthoDB 1 1.010 - - D1477492at2759
OrthoFinder 1 1.000 - - FOG0004100
OrthoInspector 1 1.000 - - oto17668
orthoMCL 1 0.900 - - OOG6_102593
Panther 1 1.100 - - LDO PTHR13120
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R611
SonicParanoid 1 1.000 - - X2842
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.