DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phf5a and ini1

DIOPT Version :9

Sequence 1:NP_609038.1 Gene:Phf5a / 33909 FlyBaseID:FBgn0031822 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_593792.1 Gene:ini1 / 2541843 PomBaseID:SPAC23H3.02c Length:117 Species:Schizosaccharomyces pombe


Alignment Length:105 Identity:73/105 - (69%)
Similarity:88/105 - (83%) Gaps:0/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKHHPDLIFCRKQPGVAIGRLCEKDDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPG 65
            |:||||||:.||:|||:.:|:|||:.|.||.||||:|||.|||||||||.:||.|.||:|||.||
pombe     1 MSKHHPDLVLCRRQPGITVGKLCERCDEKCPICDSHVRPTTLVRICDECAFGSSQDRCIICGAPG 65

  Fly    66 VSDAYYCKSCTIQEKDRDGCPKIVNLGSSKTDLFYERKKY 105
            |||.|||..||..|.||||||:::|||||:||.||||||:
pombe    66 VSDCYYCSECTRMEYDRDGCPRVINLGSSRTDWFYERKKF 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phf5aNP_609038.1 PHF5 1..104 CDD:397635 71/102 (70%)
ini1NP_593792.1 PHF5 2..104 CDD:281635 70/101 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 177 1.000 Domainoid score I840
eggNOG 1 0.900 - - E1_KOG1705
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7151
Inparanoid 1 1.050 177 1.000 Inparanoid score I1144
OMA 1 1.010 - - QHG53688
OrthoFinder 1 1.000 - - FOG0004100
OrthoInspector 1 1.000 - - oto101477
orthoMCL 1 0.900 - - OOG6_102593
Panther 1 1.100 - - LDO PTHR13120
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R611
SonicParanoid 1 1.000 - - X2842
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.