DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phf5a and ini1

DIOPT Version :10

Sequence 1:NP_609038.1 Gene:Phf5a / 33909 FlyBaseID:FBgn0031822 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_593792.1 Gene:ini1 / 2541843 PomBaseID:SPAC23H3.02C Length:117 Species:Schizosaccharomyces pombe


Alignment Length:105 Identity:73/105 - (69%)
Similarity:88/105 - (83%) Gaps:0/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKHHPDLIFCRKQPGVAIGRLCEKDDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPG 65
            |:||||||:.||:|||:.:|:|||:.|.||.||||:|||.|||||||||.:||.|.||:|||.||
pombe     1 MSKHHPDLVLCRRQPGITVGKLCERCDEKCPICDSHVRPTTLVRICDECAFGSSQDRCIICGAPG 65

  Fly    66 VSDAYYCKSCTIQEKDRDGCPKIVNLGSSKTDLFYERKKY 105
            |||.|||..||..|.||||||:::|||||:||.||||||:
pombe    66 VSDCYYCSECTRMEYDRDGCPRVINLGSSRTDWFYERKKF 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phf5aNP_609038.1 PHF5 1..104 CDD:461008 71/102 (70%)
ini1NP_593792.1 PHF5 1..104 CDD:461008 71/102 (70%)

Return to query results.
Submit another query.