DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phf5a and phf5a

DIOPT Version :9

Sequence 1:NP_609038.1 Gene:Phf5a / 33909 FlyBaseID:FBgn0031822 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001123712.1 Gene:phf5a / 100170460 XenbaseID:XB-GENE-976801 Length:110 Species:Xenopus tropicalis


Alignment Length:109 Identity:105/109 - (96%)
Similarity:106/109 - (97%) Gaps:0/109 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKHHPDLIFCRKQPGVAIGRLCEKDDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPG 65
            ||||||||||||||.||||||||||.|||||||||||||||||||||||||||||||||||||||
 Frog     1 MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPG 65

  Fly    66 VSDAYYCKSCTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKQ 109
            ||||||||.||||||||||||||||||||||||||||||||||:
 Frog    66 VSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phf5aNP_609038.1 PHF5 1..104 CDD:397635 99/102 (97%)
phf5aNP_001123712.1 PHF5 1..104 CDD:397635 99/102 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 224 1.000 Domainoid score I2496
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H7151
Inparanoid 1 1.050 234 1.000 Inparanoid score I3327
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1477492at2759
OrthoFinder 1 1.000 - - FOG0004100
OrthoInspector 1 1.000 - - oto104206
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R611
SonicParanoid 1 1.000 - - X2842
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.