DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonCOP and Cope

DIOPT Version :9

Sequence 1:NP_609037.1 Gene:epsilonCOP / 33908 FlyBaseID:FBgn0027496 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_006252938.1 Gene:Cope / 290659 RGDID:1306785 Length:308 Species:Rattus norvegicus


Alignment Length:289 Identity:113/289 - (39%)
Similarity:168/289 - (58%) Gaps:10/289 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LFDARNEYYIGNFMGSIN------FVLPEQGTAGPELLSYMYLSYLAIDSGRIVASDIKEGNSTP 72
            |||.:|.:|||::...||      ...||:..   |...::|.:|||.....:|..:||..::..
  Rat    19 LFDVKNAFYIGSYQQCINEAQRVKLSSPEREV---ERDVFLYRAYLAQRKYGVVLDEIKPSSAPE 80

  Fly    73 LQALRLVHEAFEQPSRTEELLEKLTDKVAGEEDETN-IWHLATAIVYCHDGQFENALKILHGSTN 136
            |||:|:..|.....:|.:.::.:|..:::...|.|| .:.|..|.:|.||...:.||:.||....
  Rat    81 LQAVRMFAEYLASENRRDSIVLELDREMSRSVDVTNTTFLLMAASIYFHDQNPDAALRTLHQGDG 145

  Fly   137 LESMALSVQCLLRLQRVDLAKQLVAKMQEISDDATLTQLAQAWVALAQGTEQMQDAFHIYQEFCE 201
            ||..|:::|.||:|.|:|||::.:.:|||..:||||||||.|||.||.|.|::|:|::|:||..:
  Rat   146 LECTAMTIQILLKLDRLDLARKELKRMQEQDEDATLTQLATAWVNLAMGGEKLQEAYYIFQELAD 210

  Fly   202 KFKPTPALLNGQAVVHLGLERYEEADSVLRESLLKKHNDYDTLINLMVHAHLTGKPTEAITRNLE 266
            |..||..||||||..|....|:|.|:.||:|:|.|.....:|||||:|.:...|||.|...|.|.
  Rat   211 KCSPTLLLLNGQAACHSAQGRWETAEGVLQEALDKDSGHPETLINLIVLSQHLGKPPEVTNRYLS 275

  Fly   267 QLRQFYPKSDFVTDLDKKSAEFDRLCLQY 295
            ||:..:....|:.:...|..:||||.|||
  Rat   276 QLKDAHRTHPFIKEYQAKENDFDRLALQY 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonCOPNP_609037.1 Coatomer_E 12..296 CDD:252768 113/289 (39%)
TPR repeat 175..201 CDD:276809 14/25 (56%)
TPR repeat 206..236 CDD:276809 15/29 (52%)
CopeXP_006252938.1 Coatomer_E 17..305 CDD:398419 113/289 (39%)
TPR repeat 185..210 CDD:276809 13/24 (54%)
TPR repeat 215..245 CDD:276809 15/29 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353641
Domainoid 1 1.000 191 1.000 Domainoid score I3148
eggNOG 1 0.900 - - E1_KOG3081
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5254
Inparanoid 1 1.050 191 1.000 Inparanoid score I3790
OMA 1 1.010 - - QHG54590
OrthoDB 1 1.010 - - D1161199at2759
OrthoFinder 1 1.000 - - FOG0004888
OrthoInspector 1 1.000 - - oto98172
orthoMCL 1 0.900 - - OOG6_102500
Panther 1 1.100 - - LDO PTHR10805
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4002
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.