DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KFase and PCME

DIOPT Version :9

Sequence 1:NP_001285676.1 Gene:KFase / 33907 FlyBaseID:FBgn0031821 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_197090.2 Gene:PCME / 831443 AraportID:AT5G15860 Length:427 Species:Arabidopsis thaliana


Alignment Length:258 Identity:60/258 - (23%)
Similarity:100/258 - (38%) Gaps:59/258 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 YG-EGRQLVDVFYSEKTTNQAPLFVFVHGGYWQEMDMSMSCSIVG----------PLVRRGYRVA 113
            || :.|..:|::.........|:.|||.||.|          |:|          .|..|...||
plant   135 YGDQPRNRLDLYLPSNNDGLKPVVVFVTGGAW----------IIGYKAWGSLLGMQLAERDIIVA 189

  Fly   114 VMDYNLCPQVTLEQLMTQFTHFLNWIFDYTEMTKVSS-------LTFAGHSAGAHLLAQILMRPN 171
            .:||...||.|:..::|..:..::::     ...:|:       :...|.|||||:.|..|:...
plant   190 CLDYRNFPQGTISDMVTDASQGISFV-----CNNISAFGGDPNRIYLMGQSAGAHIAACALLEQA 249

  Fly   172 VITAQRSKMVW------ALIFLCGVYDLRELSNLESVNPKNILGL----------NERNIESVSP 220
            ....:...:.|      |...|.|.|:|.:|     |:..:..||          .|.:.|..||
plant   250 TKELKGESISWTVSQIKAYFGLSGGYNLYKL-----VDHFHNRGLYRSIFLSIMEGEESFEKFSP 309

  Fly   221 MLWEYTDVTVWNSTKIY-VVAAEHDSTTF---IEQSRHYADVLRKKGYKASFTLFKGYDHFDI 279
            .: ...|..|..:..:. .:...|.|:.:   .::|:.:.|.|:..|.||...|:.|..|.|:
plant   310 EV-RLKDPVVGKAASLLPPIILFHGSSDYSIPCDESKTFTDALQAVGAKAELVLYSGKTHTDL 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KFaseNP_001285676.1 Aes <67..297 CDD:223730 57/250 (23%)
Abhydrolase 82..276 CDD:304388 53/230 (23%)
PCMENP_197090.2 Aes 130..368 CDD:223730 58/253 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I4737
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2629
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D992858at2759
OrthoFinder 1 1.000 - - FOG0002751
OrthoInspector 1 1.000 - - otm3547
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.