DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KFase and ICME-LIKE2

DIOPT Version :9

Sequence 1:NP_001285676.1 Gene:KFase / 33907 FlyBaseID:FBgn0031821 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_186890.2 Gene:ICME-LIKE2 / 821191 AraportID:AT3G02410 Length:422 Species:Arabidopsis thaliana


Alignment Length:287 Identity:63/287 - (21%)
Similarity:107/287 - (37%) Gaps:72/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GEGRQLVDVFYSEKTTNQAPLFVFVHGGYWQEMDMSMSCSIVG----------PLVRRGYRVAVM 115
            |..|..:|::....:....|:.|||.||.|          |:|          .|..|...||.:
plant   132 GHPRNRLDLYIPPTSDGLKPVVVFVTGGAW----------IIGYKAWGSLLGLQLAERDIIVACL 186

  Fly   116 DYNLCPQVTLEQLMTQFTHFLNWIFDYTEMTKVSS-------LTFAGHSAGAHLLAQILMRPNVI 173
            ||...||.|:..:::.....::::     ...:|:       :...|.|||||:.:..|....:.
plant   187 DYRNFPQGTISDMVSDAAQGISFV-----CNNISAFGGDPNRIYLMGQSAGAHISSCALFEQAIK 246

  Fly   174 TAQRSKMVW------ALIFLCGVYDLRELSNLESVNPKNI-----LGL--NERNIESVSPMLWEY 225
            .::...:.|      |...|.|.|:|..|  :|..:.:.:     |.:  .|.:.:..||.: ..
plant   247 ESRGESISWSVSQIKAYFGLSGGYNLFNL--VEHFHNRGLYRSIFLSIMEGEESFKQFSPEV-RL 308

  Fly   226 TDVTVWNSTKIYV-VAAEHDSTTFI---EQSRHYADVLRKKGYKASFTLFKGYDHFD-------- 278
            .|:.|..:..:.. :...|.|..:.   |.|:.:.|.|:....||...::||..|.|        
plant   309 KDLNVRKAAALLPHIILFHGSADYSIPPEASKTFTDALQAAEVKAELVMYKGKTHTDLFLQDPLR 373

  Fly   279 ---------IIEETAIDDSDVSRFLRN 296
                     |:.....||||.   |||
plant   374 GGKDELFDHIVSMIHADDSDA---LRN 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KFaseNP_001285676.1 Aes <67..297 CDD:223730 61/281 (22%)
Abhydrolase 82..276 CDD:304388 49/227 (22%)
ICME-LIKE2NP_186890.2 Aes 125..363 CDD:223730 53/248 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I4737
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2629
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002751
OrthoInspector 1 1.000 - - otm3547
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.