DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KFase and Aadac

DIOPT Version :10

Sequence 1:NP_609036.1 Gene:KFase / 33907 FlyBaseID:FBgn0287695 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_065413.1 Gene:Aadac / 57300 RGDID:631440 Length:398 Species:Rattus norvegicus


Alignment Length:172 Identity:46/172 - (26%)
Similarity:69/172 - (40%) Gaps:25/172 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LEHFVRVTKQHGR----ELTEKQGITVDHLRYGEGRQLVDVFYSEKTTNQAPLFVFVHGGYWQEM 93
            |.||:...:...|    ..|..:.:||....:......:.:...:.||.:..|| |:|||.|  .
  Rat    54 LNHFMDTVQLFMRFQVVPPTSDENVTVMETDFNSVPVRIYIPKRKSTTLRRGLF-FIHGGGW--C 115

  Fly    94 DMSMSCSIVGPLVRR-GYR----VAVMDYNLCPQVTLEQLMTQFTHFLNWIFDYTEMTKVS---- 149
            ..|.:..:...|.|| .:|    |...||.|.|:....:......|.|.|......:.|..    
  Rat   116 LGSAAYFMYDTLSRRTAHRLDAVVVSTDYGLAPKYHFPKQFEDVYHSLRWFLQEDILEKYGVDPR 180

  Fly   150 SLTFAGHSAGAHLLA----QILMRPNVITAQRSKM-VWALIF 186
            .:..:|.|||.:|.|    |||..|:|    :.|: |.|||:
  Rat   181 RVGVSGDSAGGNLTAAVTQQILQDPDV----KIKLKVQALIY 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KFaseNP_609036.1 Aes 68..295 CDD:440422 39/133 (29%)
AadacNP_065413.1 Abhydrolase_3 106..373 CDD:400284 37/120 (31%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 110..112 1/1 (100%)

Return to query results.
Submit another query.