DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KFase and Nceh1

DIOPT Version :10

Sequence 1:NP_609036.1 Gene:KFase / 33907 FlyBaseID:FBgn0287695 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_848887.1 Gene:Nceh1 / 320024 MGIID:2443191 Length:408 Species:Mus musculus


Alignment Length:267 Identity:57/267 - (21%)
Similarity:103/267 - (38%) Gaps:78/267 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VRVTKQHGRELTEKQGITVDHLRYGEGRQLVDVFYSEKTTNQAPL---FVFVHGGYWQEMDMSMS 98
            |:||.      |:..|:.|   |..||        |.|.  :.||   .:::|||.|......:|
Mouse    80 VKVTD------TDFDGVEV---RVFEG--------SPKP--EEPLRRSVIYIHGGGWALASAKIS 125

  Fly    99 -----CSIVGPLVRRGYRVAVMDYNLCPQVTLEQLMTQFTHFLNWIFDYTEMTKV---------- 148
                 |:.:...:..  .:..::|.|.|||          :|...|.|....||.          
Mouse   126 YYDQLCTTMAEELNA--VIVSIEYRLVPQV----------YFPEQIHDVIRATKYFLQPEVLDKY 178

  Fly   149 ----SSLTFAGHSAGAHLLAQILMRPNVITAQRSKM-VWALIF-LCGVYDLRELSNLESVN---- 203
                ..:..:|.|||.:|.|.:..:...:.:.::|: :.||:: :....|....|..:|:|    
Mouse   179 KVDPGRVGISGDSAGGNLAAALGQQFTYVASLKNKLKLQALVYPVLQALDFNTPSYQQSMNTPIL 243

  Fly   204 PKNI-----LGLNERNIESVSPMLWEYTDVTVWNSTKIYV-----VAAEHDSTTFIEQS--RHYA 256
            |:::     |...:.|.:.|..|:       |.|.|.:.|     :.|..|.|:.:..|  ::|.
Mouse   244 PRHVMVRYWLDYFKGNYDFVEAMI-------VNNHTSLDVERAAALRARLDWTSLLPSSIKKNYK 301

  Fly   257 DVLRKKG 263
            .:::..|
Mouse   302 PIMQTTG 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KFaseNP_609036.1 Aes 68..295 CDD:440422 48/236 (20%)
Nceh1NP_848887.1 Abhydrolase_3 109..381 CDD:400284 44/219 (20%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 113..115 1/1 (100%)

Return to query results.
Submit another query.