DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KFase and Aadacl2fm3

DIOPT Version :10

Sequence 1:NP_609036.1 Gene:KFase / 33907 FlyBaseID:FBgn0287695 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001099906.1 Gene:Aadacl2fm3 / 295072 RGDID:1560324 Length:401 Species:Rattus norvegicus


Alignment Length:237 Identity:46/237 - (19%)
Similarity:79/237 - (33%) Gaps:88/237 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KTTNQAPLFVFVHGGYWQEMDMSMSCSIVGPLVRRGYR-------------VAVMDYNLCPQ--- 122
            ::..:.|..:::|||.:          |:|......|.             |...||.|.||   
  Rat    99 ESERKRPAVIYIHGGAF----------ILGSFKMLPYDSMNRWTANKLDAVVIAPDYRLAPQYLF 153

  Fly   123 -VTLEQ--LMTQFTHFLNWIFDYTEMTKV--------SSLTFAGHSAGAHLLAQILMRPNVITAQ 176
             ..||.  |:|:|  ||        ..||        :.:..:|.|:|..|.|.:...       
  Rat   154 PAALEDCVLVTKF--FL--------QDKVLAKYRVDPTRICISGDSSGGTLAATVTQL------- 201

  Fly   177 RSKMVWALIFLCGVYDLRELSNLESVNPKNILGLNERNIESVSPMLWEY------TDVTVWNSTK 235
                         :.|..|..|  .:..:.:|....:.::::.|...||      |.......|.
  Rat   202 -------------LQDDPEYKN--KIRAQTLLYPGLQALDTLMPSFREYEHGPFLTRKVAIKMTC 251

  Fly   236 IYVVAAEHDSTTFI------EQSRH------YADVLRKKGYK 265
            :|:...:....|.:      ::|||      ::|.|.:| ||
  Rat   252 LYLSEDKELPKTILRNAHVPKESRHLFKFVNWSDFLPEK-YK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KFaseNP_609036.1 Aes 68..295 CDD:440422 46/237 (19%)
Aadacl2fm3NP_001099906.1 Abhydrolase_3 107..372 CDD:400284 45/229 (20%)

Return to query results.
Submit another query.